KEGG   Streptococcus agalactiae ILRI005: MSA_13060Help
Entry
MSA_13060         CDS       T02704                                 

Definition
(GenBank) Ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01130  Biosynthesis of antibiotics
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
Module
sagi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_13060
Enzymes [BR:sagi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MSA_13060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: CCW40164
LinkDB All DBs
Position
complement(1191592..1192263)
Genome map
AA seq 223 aa AA seqDB search
MDELKKLAGVTAAKYVKNGMIVGLGTGSTAYFFVEEIGRRVKEEGLQVIGVTTSNRTTEQ
ARGLGIPLKSADDIDVIDVTVDGADEVDPDFNGIKGGGGALLMEKIVATPTKEYIWVVDE
SKLVETLGAFKLPVEVVRYGSERLFRVFKSKGYCPSFRETEGDRFITDMGNYIIDLDLKK
IEDPKQLANELDHTVGVVEHGLFNGMVNKVIVASKNGLDILEK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggacgaactaaaaaaacttgctggagtgaccgctgcaaaatacgttaaaaacggtatg
attgtgggtttagggacaggttctacagcatatttttttgttgaagaaattggacgccgt
gtcaaagaagagggattgcaagtcataggcgttacaacgtcaaaccgtacgactgagcag
gcaagaggattaggtattccgttgaaatcagcagatgatattgatgtcattgatgtcact
gtggatggagcagatgaagtagaccctgattttaatggtatcaaggggggcggtggtgcg
ctgctcatggaaaaaatagtagctactccaactaaagaatatatctgggttgtcgatgag
agcaaacttgttgaaacgttaggtgcatttaaattgcctgttgaggttgttagatatggt
tctgagcgtctttttcgggtttttaaatcaaaaggttattgtccttctttccgtgaaaca
gaaggtgaccgctttatcactgatatggggaactacatcatcgacctagatttgaaaaaa
atagaggatccaaagcagttagcgaatgaacttgaccatacagttggtgttgttgaacat
ggtttatttaatggtatggttaataaagttatagtagcaagcaaaaacggtcttgacata
cttgaaaaataa

DBGET integrated database retrieval system