KEGG   Streptococcus agalactiae ILRI005: MSA_18870Help
Entry
MSA_18870         CDS       T02704                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00260  Glycine, serine and threonine metabolism
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01130  Biosynthesis of antibiotics
sagi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSA_18870
Enzymes [BR:sagi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MSA_18870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCW40743
LinkDB All DBs
Position
complement(1752444..1753469)
Genome map
AA seq 341 aa AA seqDB search
MLHFENDYNKGAHPELLNALIETNDQGLSGYGTDSYCQQAADKIREVCSCPQAEVEFLVG
GTQTNQVVISSMLASYEGVIAAETGHVSSHEAGAIEFSGHKVLTLPSHNGKLLASEVATY
IETFYADGNYQHMVFPGMVYISHPTEYGTLYSKAELEELSKICKHYQIPLFIDGARLGYG
LAAKDTDIDFPTIAALSDVFYIGGTKMGALAGEAVVFTKKNRPKQFTTIVKQHGALLAKG
RLLGLAFDRFFTDNLYLKIGKHAIDLAEELKIILEEKGYSFYLKSPTNQQFIIVENTKLA
DLAKNVAYSFWEKYDDHHTVIRLATSWSTSREDVTALRNVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttacattttgaaaatgattataataaaggagctcatccagaacttttaaatgccctt
attgaaactaatgatcaaggtctatcgggatatgggacagatagttactgtcaacaagcg
gcagataaaattcgagaagtctgttcctgtccacaagctgaagttgagtttttagtgggt
ggtactcaaacaaatcaagtagttatcagtagtatgcttgcttcttatgaaggagttatt
gctgcagaaacaggtcatgtgagtagtcatgaagcaggagccatagaattttcaggtcat
aaggtattgactttaccttctcataatgggaaattactcgcaagcgaagttgcaacttat
attgagactttttatgctgatggtaattaccaacacatggtttttccaggaatggtttat
atatcacatccaacagaatatggaacactttatagtaaagcagaactagaagagttatcg
aagatttgtaaacattatcaaatccccttatttattgacggtgctcgtctggggtatggt
ttggctgcgaaagatacagatattgatttcccaacgattgcagccttatcagatgttttt
tatattggtggaaccaaaatgggggctcttgctggggaagcagttgttttcacaaagaaa
aatcgtccaaaacagtttactacaattgtaaagcaacatggtgcgttattagccaaggga
agattgctggggcttgcttttgatcgtttctttacggataacctttacttaaaaattgga
aagcatgcgatcgacttagcagaggaattaaaaatcattttagaagaaaaaggttactca
ttctatttaaaatcaccaactaatcaacagtttattattgtagaaaatacaaaactagca
gatttagcaaagaatgtagcttatagtttttgggaaaaatatgatgaccatcatactgta
atacgtctagcaactagttggtcaactagtcgcgaagatgtaactgctttaagaaatgtc
ttgtga

DBGET integrated database retrieval system