KEGG   Streptococcus agalactiae ILRI005: MSA_19070Help
Entry
MSA_19070         CDS       T02704                                 

Definition
(GenBank) Ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi00040  Pentose and glucuronate interconversions
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
Module
sagi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_19070
   00040 Pentose and glucuronate interconversions
    MSA_19070
Enzymes [BR:sagi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     MSA_19070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim OMPdecase UPF0052 QRPTase_C PG_binding_3
Motif
Other DBs
NCBI-ProteinID: CCW40763
LinkDB All DBs
Position
complement(1772091..1772753)
Genome map
AA seq 220 aa AA seqDB search
MSTNKIAPSILAADYANFANELKRIEETTAEYVHIDIMDGQFVPNISFGADVVSSMRKHS
KLVFDCHLMVVDPERYIEAFAQAGADIMTIHVEATKHIHGALQKIKEAGMKAGVVINPGT
PVESLIPILDLVDQILIMTVNPGFGGQAFIPEMMSKVKTVAAWRKEYGHYYDIEVDGGID
NTTIKAAAEAGANVFVAGSYLFKASDLPAQVETLRVALDD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccaataaaattgccccatcgatattagcagcagactatgctaattttgctaac
gaattgaaacgtattgaagagacaacagcagaatacgttcatattgatatcatggatggt
caatttgtccctaatattagttttggtgcggatgttgtatccagcatgcgtaaacacagt
aaacttgtttttgattgtcatctgatggttgttgatccagaacgttatattgaggccttt
gctcaagctggtgctgatatcatgaccattcatgttgaagcaacgaaacacatacatggt
gcacttcaaaagataaaagaggcaggaatgaaagcaggtgtggttattaacccaggaaca
cctgtagaatctcttattcctatcttagatttggttgaccagattttaattatgactgtt
aatcctggctttggtggacaagcctttattccagaaatgatgtcaaaagtaaagacagtt
gcagcatggcgcaaagagtacggtcattattatgatattgaagttgatggcggtatagat
aatactacaattaaggcagcagcagaggctggtgcaaatgtctttgttgcaggttcttat
ctctttaaagcaagtgatttacctgcacaagtagaaaccttaagggtggcgctcgatgac
taa

DBGET integrated database retrieval system