KEGG   Streptococcus agalactiae ILRI005: MSA_19360Help
Entry
MSA_19360         CDS       T02704                                 

Definition
(GenBank) Xylulose-5-phosphate phosphoketolase / Fructose-6-phosphate phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_19360
Enzymes [BR:sagi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MSA_19360
    4.1.2.22  fructose-6-phosphate phosphoketolase
     MSA_19360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C Transket_pyr
Motif
Other DBs
NCBI-ProteinID: CCW40792
LinkDB All DBs
Position
complement(1795364..1797742)
Genome map
AA seq 792 aa AA seqDB search
MSEFDTKSYLEKLDAWWRAANYISAAQMYLKDNPLLRRELVENDLKVHPIGHWGTVPGQN
FIYAHLNRAINKYDLDMFYIEGPGHGGQVMVSNSYLDGSYTELNPNIEQTEDGFKQLCKI
FSFPGGIASHAAPETPGSIHEGGELGYALSHATGAILDNPDVIAATVIGDGEGETGPLMA
GWLSNTFINPVNDGAVLPIFYLNGGKIHNPTIFERKTDEELSQFFEGLGWKPIFADVVEL
SEDHAAAHALFAEKLDQAIQEIKTIQSEARQKSAEEAIQAKFPVLVARIPKGWTGPKAWE
GTPIEGGFRAHQVPIPVDAHHMEHVDSLLSWLQSYRPEELFDESGKIVDEIAAISPKGDR
RMSMNPITNAGIVKAMDTADWKKFALDINVPGQIMAQDMIEFGKYAADLVDANPDNFRIF
GPDETKSNRLQEVFTRTSRQWLGRRKPDYDEALSPAGRVIDSQLSEHQAEGFLEGYVLTG
RHGFFASYESFLRVVDSMVTQHFKWLRKSKTHTTWRKNYPALNLIAASTVFQQDHNGYTH
QDPGILTHLAEKTPEYIREYLPADTNSLLAVMDKAFKAEDKINLIVTSKHPRPQFYSIAE
AEELVAEGYKVIDWASNVSLNQEPDVVFAAAGTEPNLEALAAISILHKAFPELKIRFVNV
LDILKLRHPSQDARGLSDEEFNKVFTTDKPVIFAFHGYEDMIRDIFFSRHNHNLHTHGYR
ENGDITTPFDMRVMSELDRFHLAQDAALASLGNEAQVFSDEMNQMVAYHKDYIREHGDDI
PEVQNWKWENIK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatttgatacaaaatcatatttagaaaaacttgatgcatggtggagagcagct
aattatatttctgcagcacaaatgtatctaaaggataaccctctcttgagacgagagctg
gttgaaaacgacttaaaggttcatccaattggtcactggggcactgtacctggacaaaac
tttatctatgctcacttaaatcgcgctattaataaatacgatttagacatgttctatatt
gaaggtccaggtcatggtggtcaagttatggtatctaattcatatttagatggttcatat
actgaattaaacccaaatattgagcaaacagaggatggctttaagcagttatgtaaaatc
ttctctttcccaggtggaattgcatcccatgctgcaccagaaacaccagggtcaattcat
gaaggcggtgaacttggttacgcactttctcatgcgacaggtgccatcctagacaatcca
gatgttattgctgcgactgttattggtgatggtgaaggtgaaacaggaccacttatggct
ggttggctatctaatacctttatcaatccagtaaatgatggtgctgttctaccaatcttc
tatttaaatggtggtaaaattcataacccaactatctttgaacgtaagacagatgaagaa
ttatctcagttttttgaaggattaggttggaaacctatttttgcagatgttgttgaactc
tctgaggatcatgcggctgctcatgctttgtttgcagaaaaattagatcaagctattcaa
gagattaaaaccattcaatcagaagcacgacaaaaatcagcagaagaagctatccaagca
aaattccctgtcttggttgcacgtattcctaagggttggactggtccaaaagcttgggaa
ggaacaccaattgaaggtggcttccgcgctcaccaagtaccaattccagtagatgcccac
catatggaacatgttgattctcttttgtcatggcttcaatcataccgtccagaagaatta
tttgatgaaagtggtaaaatcgttgatgagattgctgctatttcaccaaaaggtgatcgt
cgcatgtccatgaatccaataaccaatgctggtattgttaaagcaatggatacagcagat
tggaagaagtttgctcttgatattaatgttccaggtcaaattatggcacaagatatgatt
gaatttggaaaatatgcagcagatttggtagatgctaatccagataatttccgtattttt
ggtccagatgaaacgaaatcaaatcgtcttcaagaagtgtttacacgtactagccgtcaa
tggcttggtcgtcgtaaaccagattatgacgaagctttaagtccagctggacgtgttatt
gattcccaattgtctgaacatcaagcagaaggtttcttagaaggttatgttttaactggt
cgtcacggcttctttgcttcatacgaatcattccttcgcgttgtagattcaatggtaaca
caacatttcaaatggttacgtaaatcaaaaacacacacaacatggcgtaaaaattatcca
gcgcttaacctaattgcagcttcaactgttttccaacaagatcataatggttatactcac
caagatccaggtattttaactcatttagctgaaaaaacacctgaatacattcgtgaatat
ttaccagcagatactaactcacttctagctgttatggataaagcgtttaaagctgaagat
aaaattaatttaattgtgacatctaagcaccctcgtccacaattttactctattgctgaa
gcagaagagttagtggcagaaggatataaggtgattgactgggcttcaaatgtgtcgctt
aatcaagagccagatgttgtctttgctgcggcgggaacagaaccaaacttagaagcttta
gcagcaattagcattcttcataaggctttcccagaacttaagattagatttgttaatgta
ttagacatcctaaaacttcgtcatccttcacaagatgctcgcggtttatcagatgaagag
tttaacaaagtctttactacagataaacctgttatttttgctttccatggttatgaagat
atgattcgagatattttctttagtcgtcacaatcataatttgcatacgcatggttaccgt
gaaaatggtgacatcacaacaccatttgatatgcgcgtgatgtcagaattggaccgattc
catctggcacaggatgcagctcttgcttctttaggaaatgaagcacaagtcttcagtgat
gaaatgaatcaaatggttgcttatcacaaagactatattcgtgaacacggagacgatatt
ccagaagtacaaaattggaaatgggaaaatatcaagtag

DBGET integrated database retrieval system