KEGG   Streptococcus agalactiae ILRI005: MSA_19470
Entry
MSA_19470         CDS       T02704                                 

Definition
(GenBank) Transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
Module
sagi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_19470
Enzymes [BR:sagi01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     MSA_19470
SSDB
Motif
Pfam: TAL_FSA
Other DBs
NCBI-ProteinID: CCW40803
LinkDB
Position
complement(1809285..1809932)
AA seq 215 aa
MKYFLDTADVFEICRLNRLEIVDGVTTNPTIISREGRDFKEVINEICQIVDGPVSAEVTG
LTCDEMVTEAREIAKWSPNVVVKIPMTEEGLAAVSQLSKEGIKTNVTLIFTVAQGLSAMK
AGATFISPFVGRLEDIGTDAYALIRDLRHIIDFYGFQSEIIAASIRGLAHVEGVAKCGAH
IATIPDKTFASLFTHPLTDKGIETFLKDWDSFKKK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaaatactttttagatactgccgatgtttttgaaatttgtcgtcttaatcgtttagaa
atcgttgatggtgttactaccaatcctactattatttcacgtgaggggcgtgactttaaa
gaagttattaacgaaatttgccaaatcgttgatggtccagttagtgcagaagtgacaggt
ttaacttgtgatgaaatggttaccgaagctagagaaatcgctaagtggtcaccaaatgtt
gttgttaaaattccaatgactgaagaaggtttagcagcagtttcacaattatcaaaagaa
ggtataaagacaaatgttacattaatatttactgtggctcaagggctttcggcaatgaaa
gctggtgcaacctttattagtccttttgtgggtcgtcttgaagatattggaacagatgct
tatgctttgattcgtgaccttcgtcacattattgatttttatggtttccaatctgagatt
attgctgctagcattcgtggattggcgcatgtggagggcgtcgctaaatgcggtgcgcac
attgccactattccagataaaacatttgcatcactatttactcacccgcttactgataaa
gggattgaaactttcttaaaagattgggatagtttcaagaagaagtag

DBGET integrated database retrieval system