KEGG   Streptococcus agalactiae ILRI005: MSA_19910Help
Entry
MSA_19910         CDS       T02704                                 

Definition
(GenBank) 2-dehydro-3-deoxygluconate kinase
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_19910
Enzymes [BR:sagi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     MSA_19910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: CCW40846
LinkDB All DBs
Position
1854036..1855043
Genome map
AA seq 335 aa AA seqDB search
MSKILFFGEPLIRITPKENDYFADSISTKLFYGGSEVNIARALQGFGQDTKLLSALPNNP
IGNSFLQFLKAQGIDTHSIQWVGERVGLYFLENSFACRKGEVVYDRDYSSLHDFRINQID
FDQLFEGVSLFHFSGITLSLDESIQEITLLLLKEAKKREITISLDLNFRSKLISPKNAKI
LFSQFATFADICFGIEPLMVDSQDTTFFNRDEATIEDIKERMISLINHFDFQVIFHTKRL
QDEWGRNHYQAYIANRKQEFVTSKEITTAVNQRIGSGDAFVAGALYQLLQHSDSKTVIDF
AVASASLKCALEGDNMFETVTAVNKVLNQSKDIIR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagattctttttttcggtgaacctctcattcgcatcactcccaaagaaaatgac
tattttgcagatagtatctcaactaaactattctatggtggctctgaagttaatatcgca
agagctctacaaggctttgggcaagatactaaactcctctcagccttacccaataatccc
ataggtaatagttttcttcaatttttaaaagcacagggtattgatactcattctattcag
tgggttggagaacgtgttgggttatatttcttagaaaattcctttgcttgcagaaaaggt
gaggtggtctacgaccgcgattatagtagtttacatgactttaggataaaccaaattgat
ttcgatcaattatttgaaggagtttctctctttcattttagtggtattacactatcatta
gatgagtctatccaagagataacactgcttcttttaaaagaagctaaaaaaagagagata
acaatctccttagatctcaattttcgcagtaaactaatttctcctaaaaatgccaaaatc
cttttttctcagttcgctacctttgcggatatttgttttggtattgaacctcttatggtt
gactcacaggacactaccttcttcaatcgcgatgaagctacaatagaggacatcaaagaa
cgaatgatttctcttataaatcactttgactttcaagtcattttccatactaaacgtcta
caggatgaatggggacgaaaccactaccaagcttacatagcaaatcgtaaacaagagttt
gtcacttcaaaagaaatcaccacagctgtaaaccagagaattggaagcggagatgctttt
gtggcgggagcgctatatcaactacttcagcactcagacagcaagacagtcattgatttc
gctgtcgctagtgcatctttaaaatgtgctttggaaggggacaatatgtttgagaccgtt
accgcagttaacaaagtactaaatcaatcgaaagacattattcgttag

KEGG   Streptococcus agalactiae ILRI005: MSA_8390Help
Entry
MSA_8390          CDS       T02704                                 

Definition
(GenBank) 2-dehydro-3-deoxygluconate kinase
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_8390
Enzymes [BR:sagi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     MSA_8390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: CCW39700
LinkDB All DBs
Position
713703..714728
Genome map
AA seq 341 aa AA seqDB search
MAKIISLGEVLLRLSPPQYHTLMQANHLKCQFGGSELNVLASLAQLGHNVGLVSALPDND
LGKMARQFILSQQISPAAIIKKEGRLGIYYYEQGFSVRTNKVIYDRNYSSFWESTLSDYD
FTSIFKGVDWFHVSGITPALTKDLYEVTRFLMTKAKEGGVKVSIDLNFRESLWSSFQEAR
EQLSPLLGLSDVCFGLEPIYLAGESEDLKDELGLSRPYLDIELLEKITQKIVQEYGLDYI
AFTQREMGYTNQYMLKSYLYHNNMLYQTDKTGVEVLDRVGTGDAFAAGLIHALLEKETPQ
RALEIAMATFKYKHTIQGDINIMTRDDIAYLIEKETNDIKR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattatttcattaggtgaggttcttttgcgcttatctccacctcaatatcac
acactgatgcaggctaatcacctaaaatgccaattcggtggttcagaacttaatgtctta
gcaagtcttgctcaactaggtcacaatgtaggattggtctcagctttgcctgataatgat
ttgggcaagatggcaagacaatttatactgtcacagcaaattagtccagctgctataatt
aaaaaagaaggacgactaggaatttattactatgaacaaggattttcggtaagaacaaat
aaggttatctacgatcgtaactattcatctttttgggaaagtaccttgagtgattatgat
tttacttctatttttaagggagtggattggtttcatgtttctggaattactccagcacta
accaaggacttatatgaggtgactcggttccttatgacaaaagctaaagaaggaggtgta
aaagtatcgattgatctcaattttcgtgagagtttatggtcatcttttcaagaggcgcgt
gagcaattatcgccactattaggattatcagatgtttgctttggcttagagccgatttat
ttagctggcgaaagtgaagatttaaaagatgagttgggcttatccagaccttaccttgat
attgaattacttgaaaagataacccaaaagattgttcaagaatatgggttagactatatt
gcctttactcaaagggaaatgggatatactaatcagtatatgttaaaatcatatttgtat
cataataatatgttatatcaaactgataaaactggcgttgaagtattagatcgtgtgggt
acgggagatgcctttgctgcaggtttaattcatgcgcttctggaaaaagaaactcctcaa
agggccttagaaatagctatggctacatttaaatacaaacataccattcaaggagatatc
aatatcatgacacgagatgatattgcttacctcattgaaaaagaaacaaatgatattaaa
cgatag

DBGET integrated database retrieval system