KEGG   Streptococcus agalactiae ILRI005: MSA_20090Help
Entry
MSA_20090         CDS       T02704                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00052  Galactose metabolism
sagi00520  Amino sugar and nucleotide sugar metabolism
sagi01100  Metabolic pathways
Module
sagi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MSA_20090
   00520 Amino sugar and nucleotide sugar metabolism
    MSA_20090
Enzymes [BR:sagi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     MSA_20090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind NAD_binding_4 NAD_binding_10 KR adh_short NmrA TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CCW40864
LinkDB All DBs
Position
complement(1875786..1876781)
Genome map
AA seq 331 aa AA seqDB search
MAVLILGGAGYIGSHMVDQLITQGKEKVIVVDNLVTGHRQAVHSDAIFYEGDLSDKTFMR
QVFRENPDVDAVIHFAAFSLVAESMENPLKYFDNNTAGMIKLLEVMNECDIKNIVFSSTA
ATYGIPEQVPILETAPQNPINPYGESKLMMETIMKWADQAYGIKFVALRYFNVAGDKPDG
SIGEDHKPETHLLPIILQVAQGVRDKIMIFGDDYNTPDGTNVRDYVHPFDLADAHILAVD
YLRQGNESNVFNLGSSTGFSNLQMLEAARRITGKEIPAQKAARRPGDPDTLIASSEKARQ
ILGWEPKFDNIDKIISSAWAWHSSHPNGYED
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcagttctgattttaggtggtgccggctacattggctcgcatatggttgatcagtta
atcacacaaggaaaagagaaagttattgttgttgataacttggtaacaggtcatcgtcaa
gcggtgcattcagatgcgattttttatgaaggagatttatccgataaaacgtttatgcgt
caagtttttagggaaaatcctgatgtagatgctgttatccattttgcggcattttcacta
gttgctgagtcaatggaaaatccattaaaatattttgataataacactgctggaatgata
aagcttttagaagtaatgaatgaatgtgatatcaaaaatattgtcttttcatcaacagct
gcaacatatggtattccagaacaagttcctattttagaaacagctcctcaaaatcctatt
aatccttatggcgaaagtaagcttatgatggaaacaattatgaaatgggctgatcaagcc
tacggtattaagtttgtcgctctacgttacttcaacgttgctggagataaaccggatggc
tcaattggggaagatcataaaccagaaacacatttgttaccaatcattcttcaagttgct
caaggagtacgtgacaaaataatgatttttggagatgattacaatactccagatggaact
aatgttcgagattatgtgcatccatttgatttggcagatgctcatatattagcagttgat
taccttcgccaagggaatgaatcaaacgtgtttaatctcggatcttcgacaggtttttct
aaccttcagatgttagaggcagctcgtcgtattactgggaaagaaattcctgctcaaaag
gcagctcgtcgtccaggagatccagatacgcttattgcttcctcagagaaagctcgtcaa
atccttgggtgggagcctaaatttgataatattgataaaattatttcatcggcatgggca
tggcattctagtcatccaaatggctacgaagattaa

KEGG   Streptococcus agalactiae ILRI005: MSA_5350Help
Entry
MSA_5350          CDS       T02704                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00052  Galactose metabolism
sagi00520  Amino sugar and nucleotide sugar metabolism
sagi01100  Metabolic pathways
Module
sagi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MSA_5350
   00520 Amino sugar and nucleotide sugar metabolism
    MSA_5350
Enzymes [BR:sagi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     MSA_5350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 KR NAD_binding_10 adh_short TrkA_N NmrA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CCW39397
LinkDB All DBs
Position
457498..458493
Genome map
AA seq 331 aa AA seqDB search
MAILVLGGAGYIGSHMVDYLLTKTDETVVVVDNLVTGHREAIHLEAIFYKGDLADKTFMR
QVFVENPSIDTVIHFAAYSLVAESMEQPLKYFNNNTSGMINLLEVMTEFAIKFIVFSSTA
ATYGIPNDIPIKEITPQRPINPYGESKLMMETIMKWADAAYGVKFVPLRYFNVAGAKPDG
SIGEDHKPETHLLPIILQVAQGKREMVMIYGDDYQTSDGTNIRDYVHPFDIAAAHLLAVD
YLRKGNPSTAFNLGSSIGFSNFQILEVARRVTGKDIPVEVTKRRIGDPDILIADSSKARD
ILGWQPEFDDIEKIISSAWAWHSRHPDGYKS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcaattttagtcttaggtggtgcaggttatattgggtctcatatggtagattactta
ctgacaaagacagatgagacagttgttgttgtagataatttagtgaccggacatagagaa
gcaatacacttagaagcaattttctacaagggagatttagcggataagacttttatgaga
caggtatttgtagaaaatcctagtattgacaccgtaattcactttgcagcctattctctg
gtagcagaatctatggagcagcctttaaaatattttaataataatacatcaggcatgatt
aatctcttagaagttatgactgaatttgctataaaatttatcgtattttcttcaactgca
gcaacttatggtattccaaacgacataccaattaaagaaataacgcctcaacgtcccatt
aatccatatggtgaaagtaagttgatgatggaaactattatgaagtgggctgatgctgct
tatggggttaaatttgttcctttgcgctattttaatgttgcaggagcaaaaccggatggt
tcaattggtgaagatcataaacctgagactcaccttttaccaatcattcttcaagtagca
caaggaaaacgcgagatggttatgatttacggtgatgattatcaaacatcagatggaacc
aatattcgtgactacgttcatccatttgatatagccgctgctcacttactagcggttgat
tatcttcgtaaaggcaatccttcaactgcgtttaatttaggttcctctataggattctct
aatttccaaattttagaagtagctcgcagagtgactgggaaagacattcctgttgaagtg
acaaaacgtcgtattggggatccagatatccttatagccgattctagcaaagcccgtgac
attttgggttggcagccagagtttgatgatattgaaaagattatctcttcagcatgggct
tggcattcgagacacccagatggctataaatcctaa

DBGET integrated database retrieval system