KEGG   Streptococcus agalactiae ILRI005: MSA_20180Help
Entry
MSA_20180         CDS       T02704                                 

Definition
(GenBank) Sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00511  Other glycan degradation
sagi00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    MSA_20180
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MSA_20180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sagi02042]
    MSA_20180
Enzymes [BR:sagi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     MSA_20180
Bacterial toxins [BR:sagi02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   MSA_20180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR NCBP3
Motif
Other DBs
NCBI-ProteinID: CCW40873
LinkDB All DBs
Position
complement(1884866..1887316)
Genome map
AA seq 816 aa AA seqDB search
MTLTFGKPSITIRRLGVITSTYMMLGFILLCGFLHPSTIYSEEIKSNINSFISIDDEKTT
APIFDSTLDKLTNSTEERQLELDSDTSDGLIVDDQKDKDMVVVLGDSDSQEKLSPPLKSE
IATEENRKQANLAELNVTQLDNRTTYIIPESSHYIAEQQRFLIESKGSSVALLNSDEFRK
TAGEDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQISLGFKKNAMQEHHLTKTFSQK
DGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHCLVCCVDNLNFEDIKSYFQYYC
HLNHQLKLPKGAILSAKTEVYRGGNFERKNKDNVFGYRIPSLLKTEKGTLLAGADERIEQ
ACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLVTSGDYSGSPINMDMALVQDTS
SKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYLNLYNNGKKSKVFTIRDKGIVY
NFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFTKHKTSPFRLAKSSYVWMSYSD
DDGRTWSSPRDITASLRQKGMKFLGIGPGKGIVLKWGPHAGRIIIPAYSTNWKSHLRGSQ
SSRLIYSDDHGKTWHTGKAVNDNRVLSNGEKIHSLTMDNKKEQNTESVPVQLKNGDIKLF
MRNLTGNLEVATSKDGGETWQNHVKRYKEIHDAYVQLSAIRFEHDKKEYILLVNANGPGK
KRQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQLNNDKFGVLYEHREKHQNSFTL
NYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgacattaacctttgggaaaccttctataacgatacgccgtctaggagtgataactagt
acatatatgatgctaggttttattttattatgtggatttttgcatcctagtacaatttat
agtgaggaaataaaatctaatataaactcttttatatcaatagatgatgaaaaaactact
gctcccatatttgactctactttagataagcttactaattcaacagaggagaggcagtta
gaattagattctgatacatcggacggtttaatagtagatgatcaaaaagataaagatatg
gtagtagtcttaggtgattctgacagtcaagaaaaattgtcacctcctctaaaatcggaa
atagcgacagaagaaaatcgtaaacaggcaaatttagcagaactaaatgtaactcaactt
gataatagaactacctatattatacccgaaagcagtcattacatcgcagaacaacagaga
ttcctgatagaatcaaagggttcttcggttgcattacttaatagcgatgaatttagaaag
acagcgggagaggatagaggttttgaaagggataagttgaggtctttggatatcattcct
aagggagatttatcgacaagtaatgtcataggtaatacggacattgctagtcagatatcg
ttgggctttaaaaagaatgcgatgcaggaacaccatcttactaaaacattctctcaaaag
gatggaaagttatcgtctgttatagaggggatgcttgctattggcaaagagaaagtagag
aaagaaataaaatatagtggtaatttatggcaaaaattaaaagctaaggcacactgcctt
gtttgctgtgttgataatttgaattttgaagatataaaatcttattttcaatattattgt
catctaaaccatcagctcaaattacctaaaggtgctatactttctgctaaaacagaagta
tataggggaggaaattttgagagaaaaaataaagataatgtgtttggttaccgtatcccc
tcattattgaaaaccgaaaaaggaactttacttgcgggagctgatgaaagaattgagcaa
gcttgtgattggggaaacataggaatggttattcgccgtagtgaggatgatggtgtcact
tggggaaaaagagaaactattgtcaatctccgtaataaccctagagttccgctagttact
agtggtgactatagtggctcacctattaatatggatatggcattagttcaagatactagc
tctaagacgaaacgtattttttcaatatatgatatgtttccagaaggaagaggcgttatt
agtattgctaacacacctgaaaaagaatatacccaaatcggaggacagtcttatcttaat
ttatataataatggaaagaaatcgaaggtttttactatccgtgacaaaggtattgtatat
aattttaaagggaaaaagactgattatcatgttataacagaaactactaaaagtgaccat
tcaaatctaggggatatttataagggaaaacagctacttggaaatatatattttacaaaa
cataaaacgtcaccatttcgtttagcaaaatcaagctatgtgtggatgtcatatagcgat
gatgatggtaggacatggtcatcacctagagatataacagcaagtcttcgtcagaaaggc
atgaaatttttgggaataggacctggaaaaggtatagttttaaaatgggggccacacgct
ggtcgtattattattcctgcctattctacgaattggaaatctcatctaagaggttcacaa
tcttcacgcctaatttattcagacgaccatggaaaaacgtggcatactggaaaagcagtc
aatgataaccgtgtactttctaatggtgaaaaaattcactcattaacaatggataataaa
aaagaacaaaatacagaatccgtacccgttcaattgaaaaatggggacattaagttattt
atgaggaatctaactggtaacctagaagtagccacaagtaaagacggcggggagacttgg
caaaaccatgttaaacgatataaggaaattcatgatgcttacgtccaactatcagctatt
cgctttgagcatgacaaaaaagagtatattttattagtgaatgctaatgggccagggaag
aagcgccaagatggatatgcacgtctagcgcaagttaatcgaaatggtagttttaagtgg
ttatatcaccatcacattcaagatggttcgtttgcttacaactctgttcaacaacttaat
aatgataaatttggtgtcctttatgaacatagagaaaaacatcaaaatagttttacttta
aattacaaagtttttaattggagttttcttagtcaaaatacagagaaacaaggcacttta
tgggagaaaatggcagcaaattggcatgttttgtttaaattttatttatga

DBGET integrated database retrieval system