KEGG   Streptococcus agalactiae ILRI005: MSA_21260Help
Entry
MSA_21260         CDS       T02704                                 

Definition
(GenBank) Deoxyribose-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_21260
Enzymes [BR:sagi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     MSA_21260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC His_biosynth DHO_dh FMN_dh
Motif
Other DBs
NCBI-ProteinID: CCW40980
LinkDB All DBs
Position
complement(1988456..1989127)
Genome map
AA seq 223 aa AA seqDB search
MEVKDILKTVDHTLLATTATWPEIQTILDDAMAYETASACIPASYVKKAAEYVSGKLAIC
TVIGFPNGYSTTAAKVFECQDAIKNGADEIDMVINLTDVKNGDFDTVEEEIRQIKAACQD
HILKVIVETCQLTKEELIELCGVVTRSGADFIKTSTGFSTAGATFEDVEVMAEYVGGGVK
IKAAGGISSLEDAEKFIALGASRLGTSRIIKIVKNQKVEEGTY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtaaaagatattttaaaaacagtagaccatactttgctagcaacaacagcaaca
tggccagaaatccaaacaattttagatgatgcaatggcttatgaaacagcttcagcatgt
attccagcctcttacgtcaaaaaagcagcagaatacgtttcaggtaaattagctatttgt
actgttattgggttcccaaatggctatagtacaactgcagcgaaggtttttgaatgtcaa
gatgctattaaaaatggtgctgatgaaattgacatggtcattaatttgacagacgttaaa
aatggggattttgatactgttgaagaagaaattcgtcaaatcaaagctgcatgtcaagac
catatcttaaaagttatcgttgagacatgtcaattaactaaagaagaacttatcgaactt
tgtggagttgtcacacgttcaggtgcagactttattaaaacctctactggtttttcgaca
gcaggtgctacatttgaagatgttgaagtgatggcagaatatgtcggcggaggtgttaaa
attaaggcagcaggtggaatttcatcattggaagatgctgaaaaatttattgctttagga
gcttcacgcttgggtactagccgtatcatcaagattgttaagaaccaaaaagttgaagaa
ggcacttattaa

DBGET integrated database retrieval system