KEGG   Streptococcus agalactiae ILRI005: MSA_22410Help
Entry
MSA_22410         CDS       T02704                                 

Definition
(GenBank) Arginine deiminase
  KO
K01478  arginine deiminase [EC:3.5.3.6]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00220  Arginine biosynthesis
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MSA_22410
Enzymes [BR:sagi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.6  arginine deiminase
     MSA_22410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidinotransf
Motif
Other DBs
NCBI-ProteinID: CCW41095
LinkDB All DBs
Position
2093677..2094909
Genome map
AA seq 410 aa AA seqDB search
MTQTHPIHVFSEIGKLKKVMLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHDAFAQA
LRNEGVEVLYLENLAAESLTNQEIREQFIDEYIGEANVRGRATKKAIRKLLLNIKDNKEL
IEKTMAGIQKSELPEIPSSEKGLTDLVESNYPFAIDPMPNLYFTRDPFATIGNGVSLNHM
FSETRNRETLYGKYIFTHHPEYGGKVPMVYDREETTRIEGGDELVLSKDVLAVGISQRTD
AASIEKLLVNIFKQNLGFKKVLAFEFANNRKFMHLDTVFTMVDYDKFTIHPEIEGDLRVY
SVTYENQDLHIEEEKGDLADLLAKNLGVEKVELIRCGGDNLVAAGREQWNDGSNTLTIAP
GVVVVYNRNTITNAILESKGLKLIKINGSELVRGRGGPRCMSMPFEREDL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacacatccaattcatgttttctcagaaattggaaaacttaaaaaagttatg
ctacaccgtccaggtaaagaaatagaaaatctgatgcctgattatttagagagactctta
tttgatgatatcccatttttggaagatgcacaaaaagaacacgatgcgtttgcacaagca
cttcgcaacgaaggagtcgaagtactttaccttgaaaatcttgctgccgagtcgttaaca
aaccaagaaattcgtgaacagtttatcgatgagtacattggcgaagcaaatgttcgcggt
cgtgctactaaaaaagctattcgaaaattattactcaatatcaaagataataaagaactt
attgaaaaaactatggcaggtatccaaaagtctgagctacctgaaatcccatcttctgaa
aaaggtctaactgatcttgtcgaatctaattatccatttgccatagatccgatgccaaat
ctttactttacacgtgatccatttgcaactattgggaatggagtttcattaaaccatatg
ttctctgaaacacgtaatcgcgaaactttatacggtaaatatatctttacacatcaccca
gagtacggtggaaaagtccctatggtctatgatcgtgaagaaacaactcgtattgaaggt
ggagatgagctcgtcctttctaaagatgtccttgccgttggcatctctcaacgtactgat
gctgcctctattgaaaaactcttagtcaatatttttaaacaaaatttaggttttaaaaag
gttttagcatttgaatttgcaaataatcgtaaatttatgcaccttgacacagtctttaca
atggttgactatgacaagtttacaattcacccagaaattgaaggtgatcttcgcgtttac
tctgtaacttacgaaaaccaagatcttcatattgaagaagaaaaaggtgatttggcagat
cttctagcgaaaaacctaggagttgagaaagtggaattgattcgttgcgggggtgacaac
ttagtcgctgctggacgtgaacaatggaatgatggttcaaatacattaactatagcacca
ggtgtcgttgtcgtttacaacagaaatacaattacaaatgcaatcttagagtccaaagga
ttgaaattaattaagattaatggaagtgaattagttcgtgggcgtggtggaccacgctgc
atgtcaatgccatttgaacgtgaagacctttaa

DBGET integrated database retrieval system