KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0106
Entry
GBS222_0106       CDS       T02656                                 

Gene name
accB
Definition
(GenBank) biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00061  Fatty acid biosynthesis
sagl00620  Pyruvate metabolism
sagl00640  Propanoate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
sagl01212  Fatty acid metabolism
Module
sagl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_0106 (accB)
   00640 Propanoate metabolism
    GBS222_0106 (accB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GBS222_0106 (accB)
SSDB
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 GCV_H RnfC_N
Other DBs
NCBI-ProteinID: CCO73947
LinkDB
Position
117364..117864
AA seq 166 aa
MDIQEIKDLMTQFDESSLREFSFKTSDGELSFSKNEGKAPLVPTMSPMSHQPEATPTIAT
SVSNEAGEQTKQATEVVSEIPESTVTVAEGDVVESPLVGVAYLASGPDKPNFVSVGDSVK
KGQTLMIIEAMKVMNEVPASHDGVVTEILVANEEVIEFGKGLVRIK
NT seq 501 nt   +upstreamnt  +downstreamnt
ttggatattcaagagattaaggatttaatgactcaatttgatgagtcaagtctgagagaa
ttttcattcaaaacaagtgacggtgagctgtcttttagtaaaaatgagggaaaagctcca
cttgtcccaactatgtctcctatgagtcatcaacctgaagcgactccaactatagcaact
tctgtctctaatgaagcaggtgagcaaacgaaacaagctactgaagtagtttcagaaatc
ccagagtcgactgtgacagttgcagaaggtgacgttgtcgaaagtcctttagttggggtt
gcttatttagcttctggaccagataaacctaactttgtttcagtaggtgatagcgtgaag
aagggacaaactttgatgattattgaggcaatgaaggtgatgaatgaagtgcctgcctct
catgatggtgtagttactgaaattcttgtagccaatgaagaagttattgaatttggtaaa
ggattggtacgaatcaaatga

KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0108
Entry
GBS222_0108       CDS       T02656                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00061  Fatty acid biosynthesis
sagl00620  Pyruvate metabolism
sagl00640  Propanoate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
sagl01212  Fatty acid metabolism
Module
sagl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_0108 (accC)
   00640 Propanoate metabolism
    GBS222_0108 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GBS222_0108 (accC)
Enzymes [BR:sagl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     GBS222_0108 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     GBS222_0108 (accC)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3
Other DBs
NCBI-ProteinID: CCO73949
UniProt: A0A380IN76
LinkDB
Position
118321..119691
AA seq 456 aa
MFKKILIANRGEIAVRIIRAAREMGISTVAIYSEADKESLHTILADEAICVGPAKSAESY
LNVNAILSAAIVTGAEAVHPGFGFLSENSKFATMCEEMNLKFIGPSGEVMDKMGDKINAR
AEMIKADVPVIPGSDGQVTSVEEAVSIAEEIGYPLMLKASAGGGGKGIRKVKSADELKPA
FESASQEALAAFGNGAMYIEKVIYPARHIEVQILGDSFGKIVHLGERDCSLQRNNQKVLE
ESPSVAIGNTLRQQIGEAAVRAAEAVSYENAGTIEFLLDENSGQFYFMEMNTRVQVEHPV
TEFVTGVDIVKEQIRIAAGIPLSVSQNDIKLTGHAIECRINAENPQFNFAPCPGTINGLH
LPAGGMGLRVDSAVYTGYTIPPYYDSMIAKVIVHGENRFDALMKMQRALYELEIDGIITN
TEFQMDLISDKKVLAGDYDTSFLMEDFLPRYYGNNQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgtttaagaaaatattgattgctaatcgcggagaaattgcagtacgtatcattcgtgca
gcccgtgaaatgggaatttcgacagttgctatctattcggaggctgacaaggaatcattg
cacacaattttagcagatgaagctatttgtgttggaccagccaaatcagcagaatcttat
ttaaacgttaatgctatattatctgctgctattgtgactggagcggaagctgttcatcca
ggttttgggtttttaagtgaaaattctaaatttgctactatgtgtgaagagatgaattta
aaattcattggtccatctggagaagttatggataaaatgggtgataaaatcaatgctcgt
gcagagatgataaaagctgatgttccggttattccaggatcagatggtcaggttacaagt
gtagaagaagctgtatcaattgctgaggaaatcggctatccattgatgttaaaagcctca
gccggtggcggtggaaaaggaattaggaaggtcaaatcagcagatgaattgaagcctgct
tttgagtctgcttcacaggaggctttggctgcgttcggtaatggtgctatgtatattgaa
aaagttatatacccagctagacatattgaagtacaaatacttggagatagctttggtaag
atagttcacctaggagaacgtgattgttctctgcagcgtaacaatcagaaggtattggaa
gaaagtccgtctgtggcaataggtaacactctgcgtcaacaaattggtgaagcagctgtt
cgtgctgctgaggctgtatcttatgaaaatgcaggaacaattgagtttttgttagatgag
aatagcggacagttctatttcatggaaatgaatactcgtgttcaagtagaacaccctgtt
acagaatttgtaacgggtgttgacatcgttaaagagcagattcgtatcgctgctggaatt
cctttatcagtttctcaaaatgatattaagttaactggtcatgcgattgaatgtcgtatt
aacgcagagaatccacaatttaattttgcgccatgtccaggtaccattaatgggttacat
ctacctgctggcggtatgggcttacgtgtcgattcagcggtttacacaggctacactatt
cctccttattatgatagtatgattgcgaaagtaattgttcacggagaaaatcgttttgat
gcacttatgaaaatgcaacgtgccttatatgagcttgaaattgatggtattataacaaat
acagaatttcaaatggatctcatttctgataaaaaagtcttggctggagattatgatact
tcattcctgatggaagactttttaccaaggtattatggtaacaatcaatag

KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0109
Entry
GBS222_0109       CDS       T02656                                 

Gene name
accD
Definition
(GenBank) acetyl-coenzyme A carboxylase carboxyl transferase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00061  Fatty acid biosynthesis
sagl00620  Pyruvate metabolism
sagl00640  Propanoate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
sagl01212  Fatty acid metabolism
Module
sagl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_0109 (accD)
   00640 Propanoate metabolism
    GBS222_0109 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GBS222_0109 (accD)
Enzymes [BR:sagl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     GBS222_0109 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     GBS222_0109 (accD)
SSDB
Motif
Pfam: Carboxyl_trans zf-ACC Cys_rich_CPCC IBR Cript RNA_POL_M_15KD
Other DBs
NCBI-ProteinID: CCO73950
UniProt: A0A3P1B4G3
LinkDB
Position
119700..120575
AA seq 291 aa
MALFSKKDKYIRISPNKALGSSDKRSLPEVPDELFAKCPSCKHMIYQKDLGLAKICPACS
YNFRISAQERLLLTVDEDSFEELFTGIETKDPLNFPNYREKLAATRQKTNLDEAVVTGLA
KIKGQTTALAIMDSHFIMASMGTVVGEKLTRLFELATEKKLPIVIFTASGGARMQEGIMS
LMQMAKVSAAVKRHSNRGLFYLTILTDPTTGGVTASFAMEGDIILAEPQALVGFAGRRVI
ETTVREDLPEGFQKAEFLLEHGFVDAIINRTELRDCIAQLIAFHGNEVGHE
NT seq 876 nt   +upstreamnt  +downstreamnt
atggctttatttagtaaaaaggataaatatatccgtattagtccaaacaaagcattaggg
tcttctgataaacgtagtcttcctgaggttcctgatgaactctttgctaagtgtccttct
tgtaaacatatgatttatcagaaagatttaggattagcaaagatttgtccagcttgttct
tacaactttagaatttcagcgcaagaacgtctgttgctaacagttgacgaagatagtttt
gaggaattatttacagggattgaaactaaggatcctttgaattttccaaactaccgtgaa
aaactggctgctacacgtcaaaagactaacttagatgaagcggtggtgacaggtttagct
aaaataaaaggacaaactacggccttagctattatggattctcattttataatggcgtct
atgggaacggtcgtaggcgaaaagttgacaagattatttgagctagcaactgaaaagaaa
ttacctattgttatttttacagcgtcagggggcgccagaatgcaagaaggtattatgagt
ttgatgcaaatggcaaaagtatcggcagcagttaaacgccattctaaccggggattgttt
tatttaacaattttaacagacccaacaaccggcggcgttactgcgagttttgctatggaa
ggtgatattattctggctgagccgcaagcgttggttggttttgctggtcgtcgtgttatc
gaaacaacagtgagagaagatttacctgaaggctttcaaaaggcagagtttttgttagaa
catggttttgtcgatgctattataaatcgaacagaattacgcgactgcattgctcaacta
attgctttccatggaaatgaggttggtcatgaataa

KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0110
Entry
GBS222_0110       CDS       T02656                                 

Gene name
accA
Definition
(GenBank) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00061  Fatty acid biosynthesis
sagl00620  Pyruvate metabolism
sagl00640  Propanoate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
sagl01212  Fatty acid metabolism
Module
sagl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_0110 (accA)
   00640 Propanoate metabolism
    GBS222_0110 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GBS222_0110 (accA)
Enzymes [BR:sagl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     GBS222_0110 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     GBS222_0110 (accA)
SSDB
Motif
Pfam: ACCA Carboxyl_trans ECH_1
Other DBs
NCBI-ProteinID: CCO73951
LinkDB
Position
120568..121341
AA seq 257 aa
MNNDVTRILKDARDQGRLTALDYAELIFDNFMELHGDRQFADDKSIIGGLGYLAGRPVTI
VGIQQGKNLQDNLDRHFGQPHPEGYRKALRLMKQAEKFGRPVITFINTAGAYPGVGAEER
GQGEAIARNLLEMSDLKVPIIAIIIGEGGSGGALALAVADKVWMLEHTVYSILSPEGFAS
ILWKDGTRTTEAAQLMKMTAGELYHMEVVDKVIPEHGYFSSEIVDMIKTNLISELEMLSQ
LSLEDLLEQRYQRFRKY
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaataatgatgtgacaagaattttaaaagatgcgcgtgatcaagggaggctaactgct
cttgactacgctgaattgatttttgataattttatggaacttcatggtgatcgccagttc
gcagatgacaaatcaattataggaggtttggggtacttggcagggcgtcctgtgacgatt
gtcggtattcaacaaggtaagaaccttcaagataatttagaccgtcattttggtcaacca
catcctgaaggttatcgtaaggctttacgtttaatgaaacaagctgagaagtttggaaga
cctgttataaccttcatcaatactgctggagcatatcctggggtaggtgctgaggagcga
ggtcagggtgaagcaattgctagaaacctcttagaaatgagtgatttaaaagtccctatt
atagctattattattggtgaagggggttctggaggagcattagctttagctgttgccgat
aaggtttggatgttggaacatactgtttattctattttaagtcctgagggctttgcttct
attttatggaaagatggtacaagaacaacagaagcagcacaattaatgaagatgactgct
ggagaactttaccatatggaagttgtagacaaagtaatccctgaacatggttatttttca
agtgagattgtcgatatgattaagacaaatttaatttcagagttagaaatgctctcacaa
ttatctcttgaggatttattggaacaacgttaccaacgttttagaaaatattaa

DBGET integrated database retrieval system