KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0204
Entry
GBS222_0204       CDS       T02656                                 

Definition
(GenBank) alcohol-acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00010  Glycolysis / Gluconeogenesis
sagl00071  Fatty acid degradation
sagl00350  Tyrosine metabolism
sagl00620  Pyruvate metabolism
sagl00625  Chloroalkane and chloroalkene degradation
sagl00626  Naphthalene degradation
sagl00650  Butanoate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBS222_0204
   00620 Pyruvate metabolism
    GBS222_0204
   00650 Butanoate metabolism
    GBS222_0204
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GBS222_0204
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GBS222_0204
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GBS222_0204
   00626 Naphthalene degradation
    GBS222_0204
Enzymes [BR:sagl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GBS222_0204
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GBS222_0204
SSDB
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Other DBs
NCBI-ProteinID: CCO74037
LinkDB
Position
220108..222750
AA seq 880 aa
MTEKTKAVETTDVALAIDTLVQNGLKALDEMRQLNQEQVDYIVAKASVAALDAHGELALH
AVEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWIEQ
PSIDATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYKEFVEEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKSAVWIAEQAGFTVPEGTNILAAECTEVSEKEPLTREKLSPVIAV
LKAESTEDGVEKARQMVEFNGLGHSAAIHTKDADLAREFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDVTTVMKG
TDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVMTVPGFIAA
DTGMDVLTHATEAYVSQMANDYTDGFALQAIKIVFDYLERSVKDADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPAATPEEAVESYAKAVYDLGTRLGIKMNFRDQGIDEKEWKEKSRELA
FLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYEERPGRRK
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgactgaaaaaactaaagcagtagaaactacagatgttgctcttgcaattgatacattg
gttcaaaatggtttaaaagcacttgatgagatgcgtcaacttaatcaagaacaagttgat
tatattgtagctaaagcttctgttgcagccttggatgcccatggagaacttgctcttcat
gcagtagaagaaactggtcgtggtgtctttgaagataaagcgacaaaaaatttatttgca
tgtgaacacgtcgttaacaacatgcgtcatacaaagacagtgggagttattgaagaagat
gatgtcacaggcttgacattaattgctgaaccagtaggagttgtctgtggtatcacgcca
acaaccaacccgacttcaactgctattttcaagtcgttaatctctcttaaaacacgtaat
ccaattatttttgccttccacccatcagcacaagaatcatcagcacatgcagcacgtatt
gttcgtgatgctgctatcgctgctggagctcctgaaaattgtgtccaatggattgaacaa
ccatcaattgatgcaactaatgctttgatgaaccatgatggtattgccactatccttgcg
acaggtggtaatgcgatggttaaagctgcctactcatgtggaaaacctgcccttggtgta
ggtgctgggaatgttccagcttatgttgaaaaatcagctaatatccgtcaagctgctcac
gatattgttatgtctaaatcatttgataacggtatggtatgtgcatcagaacaggctgtt
attattgataaagaaatttataaagaatttgttgaagaatttaaatcttatcatacctat
ttcgttaataagaaagaaaaagctcttcttgaagaattctgttttggtgcaaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgttggaaaatcagcagtttgg
attgctgaacaagctggatttactgttccagaaggaacaaatattcttgccgcagaatgt
actgaagttagtgaaaaagaacctttgacacgtgaaaaactatcacctgttattgcagta
ttgaaagctgaatctacagaagatggtgttgaaaaagctcgtcaaatggttgagtttaat
ggtctagggcactcagctgctattcatacaaaagatgcagacttagctcgtgaatttgga
actagaattcgtgctatccgtgttatttggaattctccttctacttttggtggtattggg
gatgtttacaatgctttcttgccatcattgactcttggttgtggttcgtatggacgtaac
tcagttggtgataacgttagtgctataaatctcttgaatatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagtcccttcaaaaacatacttcgaacgtgattctatt
caatatttgcaaaaatgtcgcgatgttgaacgtgtcatgattgttacagatcacgccatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatttttgctgaagtagaaccagatccagacgttacaacagtaatgaaaggg
actgatttaatgcgtaccttcaaaccagacactattattgcattaggtggtggttctcct
atggatgctgcgaaagttatgtggctcttctatgaacaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgtaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctattccaacaacttctggaacaggttctgaagtgacaccattt
gccgttatttctgacaaagcaaataatcgtaaatatccaatcgctgattattcattaaca
ccaactgtagctatcgttgatccggcccttgttatgactgttcctggttttattgcggct
gatacgggtatggatgtattgacacatgcaacagaggcttatgtttcacagatggcaaat
gattatacagacggatttgctcttcaagcaattaaaattgtatttgactacttagaacgc
tcagtaaaagatgctgattttgaagcacgtgaaaagatgcacaatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatggaactcgtccagctaaaacagcaacatggcctaagtacaattactatcgtgct
gatgaaaagtatcaagatatcgctaaattactcggcttaccagcagcaacaccagaagaa
gctgtcgaatcatatgcaaaagctgtgtatgaccttggaacacgtttaggtattaagatg
aatttccgcgaccaaggcattgatgaaaaagaatggaaagaaaaatctcgtgaactagct
ttcttagcatatgaagatcaatgttcaccagcaaatccacgccttccgatggtagatcac
atgcaagaaatcatcgaagatgcttattatggttatgaggaacgtccaggacgtcgtaag
taa

DBGET integrated database retrieval system