KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0317
Entry
GBS222_0317       CDS       T02656                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00620  Pyruvate metabolism
sagl00640  Propanoate metabolism
sagl00680  Methane metabolism
sagl01100  Metabolic pathways
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_0317 (ackA)
   00640 Propanoate metabolism
    GBS222_0317 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    GBS222_0317 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    GBS222_0317 (ackA)
Enzymes [BR:sagl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     GBS222_0317 (ackA)
SSDB
Motif
Pfam: Acetate_kinase
Other DBs
NCBI-ProteinID: CCO74140
LinkDB
Position
341344..342537
AA seq 397 aa
MSKTIAINAGSSSLKWQLYEMPEEKVVAKGIIERIGLKDSISTVKFDDKKDEQILDIVDH
TQAVKILLEDLTKHGIIKDFNEITGVGHRVVAGGEYFKESALVDDKVVEQVEELSALAPL
HNPAAAAGIRALREILPDITSVCVFDTAFHTTMQPHTYLYPIPQKYYTDYKVRKYGAHGT
SHQYVAQEAAKQLGRPLEELKLITAHVGNGVSITANYHGQSIDTSMGFTPLAGPMMGTRS
GDIDPAIIPYLVANDPELEDAAAVVNMLNKQSGLLGVSGTSSDMRDIEAGLQSKDPNAVL
AYNVFIDRIKKFIGQYLAVLNGADAIIFTAGMGENAPLMRQDVIAGLSWFGIELDPEKNV
FGYFGDITKPDSKVKVLVIPTDEELMIARDVERLKAK
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtcaaaaacaatagcaattaatgctggaagttcaagtttgaaatggcaattatatgaa
atgccagaggagaaagtagttgccaaagggattatcgaacgtattggtttgaaagattct
atttcgactgtaaaatttgacgataaaaaagatgaacaaattttagatatcgtagatcat
acccaggctgttaaaattcttttagaagatctaacaaaacatggtattatcaaagacttt
aatgaaattacaggtgttggtcatcgtgtcgttgctggtggtgaatattttaaagagtct
gctttagtagatgataaagttgtagaacaggttgaagaattatcagctttagctccactc
cacaacccagcagctgcagcagggattcgtgcgcttagagaaatcttaccagatatcacg
agtgtatgtgtatttgatacagccttccatacaacaatgcaacctcatacctacttatat
ccaatcccacaaaagtactatactgattataaagtacgtaaatacggtgcacatgggaca
agccaccaatacgttgcacaagaagcagctaagcaattaggacgtcctttagaagaatta
aaattaatcacagcacatgtgggtaatggtgtttctattacagcaaattatcatggacag
tctattgatacatcaatgggattcacaccacttgcaggaccaatgatgggaacacgttca
ggagacattgatcctgcgataatcccttatcttgtagctaatgatccagaattggaagat
gcagcagctgttgttaatatgcttaacaaacaatcaggattgcttggagtatcaggcact
tcaagtgatatgcgagatattgaagcaggccttcaaagtaaagatccaaatgcagtgtta
gcctataatgtctttattgaccgtattaagaaatttattggacaatacttggcagtatta
aatggcgcggatgctattatttttactgcaggtatgggagaaaatgcgccattaatgcgt
caagatgttatcgcaggattatcatggtttggcattgaacttgatccagaaaaaaatgtt
tttggttattttggagatatcacaaaaccagattcaaaagtgaaggttttagttattcct
actgatgaagaattaatgattgcgcgtgacgttgagcgccttaaagctaaataa

DBGET integrated database retrieval system