KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0499
Entry
GBS222_0499       CDS       T02656                                 

Definition
(GenBank) metallo-beta-lactamase family protein
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_0499
Enzymes [BR:sagl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     GBS222_0499
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2 Lactamase_B_3 Lactamase_B_6
Other DBs
NCBI-ProteinID: CCO74296
LinkDB
Position
complement(524262..524897)
AA seq 211 aa
MKIYKTINHIAGENTYYLVNDQAVILIDPGSNGQEIIAKIKSFEKPLVAILLTHTHYDHI
FSLDLVRDTFDNPPVYVSEKEAAWLSSPDDNLSGLGRHDDIINVIARPAENFFKLKQPYQ
LNGFEFTVLPTPGHSWGGVSFVFHSDELVVTGDALFRETIGRTDLPTSNFEDLITGIRQE
LFTLPSHYSVHPGHGMNTTIGHEKNFNPFFQ
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaaaatctataaaacaataaaccacattgctggcgaaaatacttattacctcgttaat
gatcaagctgttatcctcattgatccagggagcaatggccaagaaattattgctaaaatt
aaatcctttgaaaaacctttagtggctatcctcttaactcatactcactatgatcatatt
tttagtttagatttggtcagagatacttttgataatccacctgtttatgtttcagaaaaa
gaagccgcttggctatcttccccagatgataatttatctgggttaggccgtcatgatgat
atcattaatgttatagcaagaccggcagagaacttttttaaattaaagcaaccctatcaa
ctaaatggttttgaattcacagttttaccaacacctggtcattcttggggaggagtctcg
tttgttttccactcagatgaattagtcgttactggcgatgctctatttcgtgaaactatc
ggtcgtactgacttacctaccagtaactttgaggacctcattactggtattcgccaagaa
ctattcaccttacctagtcattatagtgttcacccaggccatggcatgaatacaactatt
ggccacgaaaaaaactttaatcctttcttccaatga

DBGET integrated database retrieval system