KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0569
Entry
GBS222_0569       CDS       T02656                                 

Gene name
ldhA
Definition
(GenBank) D-lactate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
sagl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_0569 (ldhA)
Enzymes [BR:sagl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     GBS222_0569 (ldhA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN NAD_binding_2 3HCDH_N AdoHcyase_NAD AlaDh_PNT_C UDPG_MGDP_dh_N DpaA_N Pyr_redox NAD_binding_7
Other DBs
NCBI-ProteinID: CCO74352
LinkDB
Position
597361..598353
AA seq 330 aa
MKLKVFNVREEEATLAQDWANRNHVELSMSEGPLTLETVNEVEGFDGVANAQIGPLDDAI
YPLLKEMGIKQIAQRSAGVDMYNLELAKQHGIIISNVPSYSPESIAEFTVTIALNLIRKV
ELIRANVREQNFSWTLPIRGRVLGNVTVAIIGTGRIGLATAKIFKGFGCRVIGYDIYHNP
MADGILEYVNSVEEAVEKADLVSLHMPPTAENTHLFNLDMFKQFKKGAILMNMARGALVE
TKDLLEALDQGLLEGAGIDTYEFEGPYIPKNCQGQDISDKDFLRLINHPKVIYTPHAAYY
TDEAVKNLVEGALNACVEVVETGTTTTRVN
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaaactcaaagtatttaatgttagagaagaagaagcaacattagcacaagattgggca
aaccgaaatcatgtggaactttctatgagtgaaggacctttgacattggaaactgttaat
gaggtagaaggttttgatggggttgctaatgcacagattgggcctttagatgacgctatt
tatcctcttctcaaagaaatgggaattaagcaaatcgctcagcgcagtgctggtgtcgat
atgtataatcttgagttagctaagcaacatggtattatcattagcaatgtgccaagttac
tcaccggagtctattgcagaatttacagtgacaatcgctcttaaccttattcgaaaagtt
gagcttattagagctaatgttcgtgaacagaatttttcatggaccttgccaattcgagga
cgagtcctaggtaacgtgactgtggctataataggaactggtcgcattggtctagcgact
gctaaaatttttaaagggttcggatgtcgtgttattggttatgatatttaccataatcca
atggcagatggtatccttgagtatgtcaattcggtagaagaagctgttgaaaaagctgat
cttgtgtccttacatatgccaccaactgctgaaaatacgcatctatttaatttagacatg
tttaaacagtttaaaaaaggtgctattttaatgaatatggcacgtggagcattggtggaa
accaaagatcttcttgaggctttagatcaagggcttttggagggagctggtattgatact
tatgaatttgaggggccatatatacctaaaaattgtcaaggtcaagacatttcagacaag
gatttcctaagactgattaatcatccgaaagtaatatacactcctcatgcggcttattat
acagatgaagcggtcaaaaatctagtagagggtgccttaaatgcttgtgtagaagtggtt
gaaacgggaacaactactacgagagtcaactaa

DBGET integrated database retrieval system