KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0749
Entry
GBS222_0749       CDS       T02656                                 

Definition
(GenBank) acetoin dehydrogenase (TPP-dependent) alpha chain
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00010  Glycolysis / Gluconeogenesis
sagl00020  Citrate cycle (TCA cycle)
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
Module
sagl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBS222_0749
   00020 Citrate cycle (TCA cycle)
    GBS222_0749
   00620 Pyruvate metabolism
    GBS222_0749
Enzymes [BR:sagl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     GBS222_0749
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N DUF1194
Other DBs
NCBI-ProteinID: CCO74511
UniProt: R4ZB74
LinkDB
Position
794165..795133
AA seq 322 aa
MVTLSKEQHLDMFLKMQRIRDVDMKFNKLVRRGFVQGMTHFSVGEEAASVGAIQDLTDSD
IIFSNHRGHGQTIAKGIDIGGMFAELAGKATGTSKGRGGSMHLANLEKGNYGTNGIVGGG
YALAVGAALTQQYEGTDNIVIAFSGDSATNEGSFHESVNLAAVWNLPVIFFIINNRYGIS
TDITYSTKIPHLYMRADAYGIPGHYVEDGNDLMAVYEKMHEVINYVRSGNGPAIVEVESY
RWFGHSTADAGVYRTKEEVDSWKAKDPVKRYRAYLIENEIATEEELAAIEAQVIKEVEEG
VKFAEESPFPDMSVAFEDVFVD
NT seq 969 nt   +upstreamnt  +downstreamnt
atggtaactctatctaaagaacaacacttggatatgtttctaaaaatgcaacgtattcgt
gatgttgatatgaaatttaacaaattggttcgtcgtggtttcgtccaagggatgactcac
ttctctgttggtgaagaagctgcttcagtaggtgctatccaagatttaacagattcagat
atcattttctcaaaccaccgtggacacggacaaactattgcaaaaggtattgatattggt
ggaatgtttgctgaacttgctggtaaagcaacaggaacatcaaaaggtcgtggaggctca
atgcacttagcaaaccttgaaaaaggtaactatggaacaaacggtatcgtcggtggagga
tatgcgcttgcagtaggtgctgcccttacacagcaatatgaaggaactgataacattgtt
atcgccttttcgggtgactcagcgactaacgagggctcattccatgagtcagttaactta
gctgctgtttggaacttaccagttatcttctttatcatcaacaaccgttatggtatctca
acagacatcacatactcaactaaaattcctcacctttacatgcgtgctgatgcgtacggt
attccagggcattatgttgaagatggtaatgaccttatggctgtttacgagaaaatgcat
gaagttatcaattacgtgcgttcaggaaatggaccagctattgtagaggttgaatcatac
cgttggtttggtcattcaactgctgatgctggggtataccgtactaaagaagaagttgat
tcatggaaagctaaagatccagtaaaacgctaccgtgcatacttaattgaaaatgaaatc
gctactgaagaagagcttgcagctattgaagcacaagtgattaaagaagttgaagaaggg
gttaaattcgctgaagaaagtccattccctgatatgtctgttgcatttgaagacgttttt
gtggactaa

KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0750
Entry
GBS222_0750       CDS       T02656                                 

Definition
(GenBank) acetoin dehydrogenase (TPP-dependent) beta chain
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00010  Glycolysis / Gluconeogenesis
sagl00020  Citrate cycle (TCA cycle)
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
Module
sagl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBS222_0750
   00020 Citrate cycle (TCA cycle)
    GBS222_0750
   00620 Pyruvate metabolism
    GBS222_0750
Enzymes [BR:sagl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     GBS222_0750
SSDB
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Other DBs
NCBI-ProteinID: CCO74512
UniProt: R4ZC70
LinkDB
Position
795208..796206
AA seq 332 aa
MSETKVMALREAINVAMSEEMRKDEKVFLMGEDVGVYGGDFGTSVGMLEEFGAKRVRDTP
ISEAAIAGSAIGAAQTGLRPIVDLTFMDFVTIAMDAIVNQGAKTNYMFGGGLSTPVTFRV
ASGSGIGSAAQHSQSLEAWLTHIPGLKVVAPGTVNESKALLKSSILDNNPVIFLEPKALY
GKKEEVNMDPDFYIPLGKGDIKREGTDLTIVSYGRMLERVMQAAEEVAEEGINVEVVDPR
TLIPLDKELIIDSVKKTGKLILVNDAYKTGGFTGEIATMVAESEAFDYLDHPIVRLASED
VPVPYSRVLEQGILPDVAKIKDAIYKVVNKGK
NT seq 999 nt   +upstreamnt  +downstreamnt
atgagcgaaactaaagttatggctttgcgcgaagcgattaatgtcgctatgagcgaagaa
atgcgcaaagatgaaaaagtatttttaatgggtgaagatgtaggtgtatatggaggagac
ttcggtacatcagttggtatgttagaagagtttggtgctaagcgcgttcgcgacacacca
atctcagaggctgcgattgcaggttcagctatcggtgctgcacaaacaggtttgcgtcct
atcgttgatttgacattcatggatttcgtaacaatcgcaatggatgctatcgttaaccaa
ggtgctaaaacgaattatatgtttggtggaggtctatcaactccagttactttccgtgtg
gcatcagggtcaggtattggttcggctgcacaacactcacaatcattagaagcttggtta
acacacattccaggtctaaaagttgttgcacctggtactgttaatgagtcaaaagcactt
ttgaaatcttctattcttgacaataacccagttatcttcttagagccaaaagctctctat
ggtaagaaagaagaagttaacatggatcctgatttctatattccacttggtaaaggggat
attaagcgtgagggtactgacttaacaattgtttcttatggccgtatgcttgagcgtgtt
atgcaagctgctgaagaagttgctgaggaaggtattaacgttgaggttgttgatccacgt
acacttattccgcttgataaagaattaattatcgattctgttaagaaaactggtaaattg
atcttggttaacgatgcttataaaactggtggtttcactggtgaaattgcaactatggtt
gctgaaagtgaagcatttgattaccttgatcatcctatcgtgcgtcttgcaagtgaagat
gttccagtaccgtattcacgtgtactggaacaaggaatcttacctgatgtagcaaaaatt
aaagatgctatctacaaagtagttaacaaaggtaaataa

DBGET integrated database retrieval system