KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0751Help
Entry
GBS222_0751       CDS       T02656                                 

Definition
(GenBank) acetoin dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00010  Glycolysis / Gluconeogenesis
sagl00020  Citrate cycle (TCA cycle)
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01130  Biosynthesis of antibiotics
sagl01200  Carbon metabolism
Module
sagl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBS222_0751
   00020 Citrate cycle (TCA cycle)
    GBS222_0751
   00620 Pyruvate metabolism
    GBS222_0751
Enzymes [BR:sagl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GBS222_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 PYNP_C PLA2_B
Motif
Other DBs
NCBI-ProteinID: CCO74513
LinkDB All DBs
Position
796333..797721
Genome map
AA seq 462 aa AA seqDB search
MAVEIIMPKLGVDMQEGEILEWKKQVGDVVNEGDVLLEIMSDKTTMEIEAEDSGVLLKIT
HGNGDVVPVTETIGYIGAEGEEVTEASSSENTSVEENATQVTSEPEKVEETSEPSVPAAT
NGEKVRATPAARKLAREMSIDLALVSGTGANGRVHREDVESFKGAQPRITPLARRIAEDQ
GVDIAEITGSGIRGKIVKNDVLAAMSPQAAEAPVETKATPTTEEKQLPEGVEVIKMSAMR
KAISKGMTNSYLTAPSFTLNYDIDMTEMMALRKKLIDPIMAKTGLKVSFTDLIGMAVVKT
LMKPEHRYLNASLINDAQEIELHNFVNIGIAVGLDDGLIVPVVHNADQMSLSDFVIASKD
VIKKTQEGKLKSAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPTPTVVDGE
IVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMEKPFGLLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgcctaaactcggggttgatatgcaagaaggcgaaatcctt
gagtggaaaaaacaggtaggtgatgttgttaatgaaggtgacgtcctacttgaaattatg
tcagataaaacaactatggagattgaagcagaagactcaggtgttttactaaaaatcaca
catgggaatggagatgttgttcctgtaactgagacaattggctatattggtgctgaaggt
gaagaagtaacagaagcatcttcttctgaaaatacatcagttgaagaaaacgcgacacaa
gtaacttcagaaccagaaaaagttgaagaaacatcagaaccaagtgtgccagcagctaca
aatggtgaaaaagtacgtgccactcctgcagctcgtaaattagcaagagagatgtctatt
gaccttgcactagtatctggaacaggggcaaatggtcgcgttcacagagaagatgttgaa
agcttcaagggtgctcaaccacgtattacaccattggcacgtcgaattgctgaagatcaa
ggagttgatatagcagaaatcactggcagtggtattcgtggtaaaattgttaaaaatgat
gttttagctgctatgtcaccgcaagcagcagaggctcctgtagaaactaaagctacacca
acaacagaagaaaaacaattaccagaaggtgttgaagtcattaagatgtctgcaatgcgt
aaggctatttctaaaggtatgactaattcttacctcactgctccaagctttacacttaac
tatgacattgatatgactgaaatgatggctcttcgcaagaaattaattgatccaatcatg
gctaaaacaggcttgaaagtcagctttactgatttgattggaatggccgttgttaagaca
ttgatgaaaccagagcatcgatacctaaatgcttcattaattaacgatgcacaagaaatt
gagcttcataattttgttaatattggaatcgcagttggtcttgatgatggtttgattgtt
cctgttgttcacaatgctgatcaaatgtcactttctgactttgttatagcatctaaagat
gttattaagaaaactcaagaaggtaaattaaaatcagctgaaatgtcaggttcaacattc
tcaattactaacttaggtatgtttggtactaagacgtttaacccaattatcaatcaaccg
aactcagcaatccttggagtaggcgctactattccgactccaacagtggttgatggtgaa
attgtagctcgaccaatcatggcaatgtgtttaacaattgaccaccgtattgttgatgga
atgaatggtgctaagtttatggttgatcttaagaacttaatggaaaaaccatttggttta
cttatttga

DBGET integrated database retrieval system