KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0752
Entry
GBS222_0752       CDS       T02656                                 

Definition
(GenBank) acetoin dehydrogenase E3 component (dihydrolipoamide dehydrogenase)
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00010  Glycolysis / Gluconeogenesis
sagl00020  Citrate cycle (TCA cycle)
sagl00260  Glycine, serine and threonine metabolism
sagl00280  Valine, leucine and isoleucine degradation
sagl00310  Lysine degradation
sagl00380  Tryptophan metabolism
sagl00620  Pyruvate metabolism
sagl00630  Glyoxylate and dicarboxylate metabolism
sagl00640  Propanoate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
Module
sagl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBS222_0752
   00020 Citrate cycle (TCA cycle)
    GBS222_0752
   00620 Pyruvate metabolism
    GBS222_0752
   00630 Glyoxylate and dicarboxylate metabolism
    GBS222_0752
   00640 Propanoate metabolism
    GBS222_0752
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GBS222_0752
   00280 Valine, leucine and isoleucine degradation
    GBS222_0752
   00310 Lysine degradation
    GBS222_0752
   00380 Tryptophan metabolism
    GBS222_0752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagl04147]
    GBS222_0752
Enzymes [BR:sagl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     GBS222_0752
Exosome [BR:sagl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GBS222_0752
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Biotin_lipoyl Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 FAD_binding_3 NAD_binding_8 HI0933_like 3HCDH_N Biotin_lipoyl_2 DAO HlyD_3 Thi4 Trp_halogenase
Other DBs
NCBI-ProteinID: CCO74514
LinkDB
Position
797781..799538
AA seq 585 aa
MAFDVIMPKLGVDMQEGEILEWKKNEGDTVNEGDVLLEIMSDKTNMEIEAEDTGVLLKIV
HQAGDVVPVTEVIAYIGEEGEEVGTSSPSADATITAEDGQSVSGPAAPSQETVAAATPKE
ELAADEYDIVVVGGGPAGYYAAIRGAQLGGKIAIVEKTEFGGTCLNVGCIPTKTYLKNAE
ILDGLKVAAGRGINLASTNCAIDMDKTVAFKNSVVKTLTGGVRGLLKANKVEIFNGLGQV
NPDKSVVIGDKVIKGRNVVLATGSKVSRINIPGIESPLVLTSDDILDLREIPKSLAVMGG
GVVGIELGLVWASYGVDVTVIEMADRIIPAMDKEVSLELQKIFAKKGMKIKTSVGVSEIV
EANNQLTLKLNNGEEVVADKALLSIGRVPQMNGLENLEPELEMERGRIKVNAYQETSIPG
IYAPGDVNGTRMLAHAAYRMGEVAAENALGGNKRKAHLDFTPAAVYTHPEVAMVGMTEEQ
AREQYGDILVGKNSFTGNGRAIASNEAHGFVKVIAEPKYKEILGVHIIGPAAAELINEAS
TIMENELTVYDVAQTIHGHPTFSEVMYEAFLDVLGEAIHNPPKRK
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggcttttgatgtaattatgccaaaacttggggttgacatgcaagaaggcgaaatcctt
gagtggaaaaaaaatgaaggtgacaccgttaatgaaggtgatgtccttcttgaaatcatg
tctgataaaaccaatatggaaattgaagcagaagacactggtgtacttttaaaaattgta
catcaggcaggagatgttgttcccgtcactgaagtaattgcctatatcggagaagaaggt
gaagaagtaggtacgtcatcaccttcagctgatgcaactatcacagctgaagatggtcaa
tcagtttctggacctgctgctccttcacaagagacagttgcagcagcaactcctaaagaa
gaacttgcagctgatgagtacgatatcgtagtcgtaggtggtggacctgcaggttattac
gcagcaatccgcggtgctcaacttggaggaaaaattgccattgttgagaaaactgaattt
ggtggtacgtgtttgaatgttggttgtatccctacaaaaacatatcttaaaaatgctgaa
atcctagatggtttgaaagtagcagctggacgtggtatcaaccttgcttcaactaactgt
gcaattgatatggataagactgttgcctttaaaaattctgtagttaagacactgactggt
ggtgtacgtggtctcttgaaagcgaacaaagttgaaattttcaatggacttggacaagta
aaccctgataaatctgttgttattggcgataaagttatcaaaggtcgtaacgtcgtcctt
gcgactggctctaaggtatctcgtattaatattccaggtattgaatcaccattagtatta
acatcagatgatattcttgatttacgtgaaattcctaagtcacttgctgttatgggtggt
ggtgtcgtaggtattgagcttggtcttgtatgggcttcatacggtgttgacgtaactgtt
attgaaatggctgatcgcatcattccagcaatggataaagaagtatcgctagaacttcaa
aaaatctttgctaaaaagggaatgaagattaaaacatcagttggtgtttctgaaattgtt
gaagccaataatcaattaacgcttaaattaaacaacggtgaagaagttgttgctgataaa
gctcttctttcaattggacgtgttccacaaatgaatggtcttgaaaatcttgagcctgaa
cttgagatggaacgtggacgtattaaagttaatgcttatcaagaaacttcaattccaggt
atctatgcaccaggtgatgttaatggaactcgtatgttagctcatgctgcataccgtatg
ggtgaagtagctgctgaaaacgcactcggcggtaataagcgtaaagcacatctagatttc
actccagcagctgtttatactcatcctgaagtagcaatggtggggatgacagaagagcaa
gcgcgtgaacaatatggtgacatattagttggtaaaaatagcttcacaggcaatggtcgt
gctatcgcttcaaacgaagcacatggttttgtaaaagtaattgctgaacctaagtataaa
gagattcttggtgttcacattattggtccagctgcagcggaattgattaatgaagcttct
acgattatggaaaatgagttgactgtctacgatgtagcacaaactatccatggtcaccca
acattctctgaagttatgtacgaagctttcttagatgttctcggtgaagctattcacaac
cctccaaaacgcaaataa

DBGET integrated database retrieval system