KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0786
Entry
GBS222_0786       CDS       T02656                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00010  Glycolysis / Gluconeogenesis
sagl00230  Purine metabolism
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
sagl01230  Biosynthesis of amino acids
Module
sagl_M00002  Glycolysis, core module involving three-carbon compounds
sagl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sagl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBS222_0786 (pyk)
   00620 Pyruvate metabolism
    GBS222_0786 (pyk)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GBS222_0786 (pyk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sagl04131]
    GBS222_0786 (pyk)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagl04147]
    GBS222_0786 (pyk)
Enzymes [BR:sagl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     GBS222_0786 (pyk)
Membrane trafficking [BR:sagl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GBS222_0786 (pyk)
Exosome [BR:sagl04147]
 Exosomal proteins
  Proteins found in most exosomes
   GBS222_0786 (pyk)
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-ProteinID: CCO74543
LinkDB
Position
836138..837640
AA seq 500 aa
MNKRVKIVATLGPAVEFRGGKKFGESGYWGESLDVEASAEKIAQLIKEGANVFRFNFSHG
DHAEQGARMAIVRKAEEIAGQKVGFLLDTKGPEIRTELFEDGADFHSYTTGTKLRVATKQ
GIKSTPEVIALNVAGGLDIFDDVEVGKQILVDDGKLGLTVFAKDKDTREFEVVVENDGLI
GKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVNEVRAICEETGN
GHVKLFAKIENQQGIDSIDEIIEAADGIMIARGDMGIEVPFEMVPVHQKMIITKVNAAGK
AVITATNMLETMTDKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATID
KNAQTLLNEYGRLDSSAFPRNNKTDVIASAVKDATHSMDIKLVVTITETGNTARAISKFR
PDADILAVTFDEKVQRSLMINWGVIPVLADKPASTDDMFEVAERVALEAGLVESGDNIVI
VAGVPVGTGGTNTMRVRTVK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgaataaacgcgtaaaaatcgttgcaacacttggtcctgcggtagaattccgtggtggt
aagaagtttggtgagtctggatactggggtgaaagccttgacgtagaagcttcagcagaa
aaaattgctcaattgattaaagaaggtgctaacgttttccgtttcaacttctcacatgga
gatcatgctgagcaaggagctcgtatggctattgttcgtaaagcagaagagattgcagga
caaaaagttggcttcctccttgatactaaaggacctgaaattcgtacagaactttttgaa
gatggtgcagatttccattcatatacaacaggtacaaaattacgtgttgctactaagcaa
ggtatcaaatcaactccagaagtgattgcattgaatgttgctggtggacttgacatcttt
gatgacgttgaagttggtaagcaaatccttgttgatgatggtaaactaggtcttactgtg
tttgcaaaagataaagacactcgtgaatttgaagtagttgttgagaatgatggccttatt
ggtaaacaaaaaggtgtaaacatcccttatactaaaattcctttccctgcacttgcagaa
cgcgataatgctgatatccgttttggacttgagcaaggacttaactttattgctatctca
tttgtacgtactgctaaagatgttaatgaagttcgtgctatttgtgaagaaactggcaat
ggacacgttaagttgtttgctaaaattgaaaatcaacaaggtatcgatagtattgatgag
attatcgaagcagcagatggtattatgattgctcgtggtgatatgggtatcgaagttcca
tttgaaatggttccagttcaccaaaaaatgatcattactaaagttaatgcagctggtaaa
gcagttattacagcaacaaatatgcttgaaacaatgactgataaaccacgtgcgactcgt
tcagaagtatctgatgtcttcaatgctgttattgatggtactgatgctacaatgctttca
ggtgagtcagctaatggtaaatacccagttgagtcagttcgtacaatggctactattgat
aaaaatgctcaaacattactcaatgagtatggtcgcttagactcatctgcattcccacgt
aataacaaaactgatgttattgcatctgcggttaaagatgcaacacactcaatggatatc
aaacttgttgtaacaattactgaaacaggtaatacagctcgtgccatttctaaattccgt
ccagatgcagacattttggctgttacatttgatgaaaaagtacaacgttcattgatgatt
aactggggcgttatccctgtccttgcagacaaaccagcatctacagatgatatgtttgaa
gttgcagaacgtgtagcacttgaagcaggacttgttgaatcaggcgataatatcgttatc
gttgcaggtgttcctgtaggtacaggtggaactaacacaatgcgtgttcgtactgttaaa
taa

DBGET integrated database retrieval system