KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0803
Entry
GBS222_0803       CDS       T02656                                 

Gene name
ldh
Definition
(GenBank) L-Lactate Dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00010  Glycolysis / Gluconeogenesis
sagl00270  Cysteine and methionine metabolism
sagl00620  Pyruvate metabolism
sagl00640  Propanoate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBS222_0803 (ldh)
   00620 Pyruvate metabolism
    GBS222_0803 (ldh)
   00640 Propanoate metabolism
    GBS222_0803 (ldh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GBS222_0803 (ldh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagl04147]
    GBS222_0803 (ldh)
Enzymes [BR:sagl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     GBS222_0803 (ldh)
Exosome [BR:sagl04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   GBS222_0803 (ldh)
  Exosomal proteins of breast milk
   GBS222_0803 (ldh)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C
Other DBs
NCBI-ProteinID: CCO74557
LinkDB
Position
complement(852303..853292)
AA seq 329 aa
MTATKQHKKVILVGDGAVGSSYAFALVNQGIAQELGIIEIPALFDKAVGDAEDLSHALAF
TSPKKIYAATYADCADADLVVITAGAPQKPGETRLDLVGKNLAINKSIVTQVVESGFNGI
FLVAANPVDVLTYSTWKFSGFPKERVIGSGTSLDSARFRQALADKIGVDARSVHAYIMGE
HGDSEFAVWSHANVAGVQLKQWLQENRDIDEQGLVDLFISVRDAAYSIINKKGATYYGIA
VALARITKAILDDENAVLPLSVYQEGQYGDVKDVFIGQPAIVGAHGIVCAVNIPLNDAEL
QKMQASAEQLKDIIDEAWKNPEFQEASKN
NT seq 990 nt   +upstreamnt  +downstreamnt
atgactgcaactaaacaacataaaaaagttatcctcgttggtgatggtgccgtaggttct
tcttacgcttttgcacttgttaaccaaggtattgcgcaagagttaggtatcattgaaatc
ccagctttatttgataaagctgttggtgatgctgaagatctttcacatgcccttgcattt
acatcacctaaaaaaatctacgcagctacttatgcagactgcgcagatgctgaccttgtt
gtcattactgctggtgcacctcaaaaaccaggtgaaactcgacttgaccttgttggtaaa
aacttagcaattaacaaatcaatcgtaactcaagttgttgaatcaggtttcaacggtatc
ttcttagtagcggctaaccctgtagatgtacttacatattcaacttggaaattctcaggt
ttccctaaggaacgcgttattggttcaggtacttcacttgactctgcacgtttccgtcaa
gctttagcagataaaattggtgttgatgctcgttcagttcacgcatacatcatgggtgaa
cacggtgactcagaatttgccgtttggtcacatgctaacgttgctggtgtccaacttaaa
caatggttacaagaaaatcgcgatattgatgaacaaggacttgttgatttgtttatttca
gttcgtgacgctgcatactcaatcatcaacaaaaaaggcgctacatattacggtattgct
gtcgcacttgctcgtattactaaagctatccttgatgatgaaaatgcagttcttccatta
tctgtatatcaagaaggccaatacggtgatgttaaagatgtctttatcggtcagcctgca
atcgtaggtgcacatggtatcgtttgtgcagttaatatcccattaaatgatgctgaactt
caaaaaatgcaagcctcagctgaacaattaaaagatattattgacgaagcttggaaaaac
ccagaattccaagaagcatcaaaaaactaa

DBGET integrated database retrieval system