KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_1226
Entry
GBS222_1226       CDS       T02656                                 

Gene name
gloA
Definition
(GenBank) S-D-lactolyglutathione methylglyoxal lyase
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_1226 (gloA)
Enzymes [BR:sagl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     GBS222_1226 (gloA)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_6 Glyoxalase_3 CppA_N Glyoxalase_2
Other DBs
NCBI-ProteinID: CCO74914
LinkDB
Position
1285808..1286200
AA seq 130 aa
MPFLHTCIRVKDLDASIAFYQEALGFKEVRRNDFPENQFTLVYMALEDDPSYELELTYNY
DHEAYDLGNGYGHIAVGVDDLETTYDAHQKAGYSVTKISGLPGKPNMFYFIQDPDGYKIE
VIRLNQFKAD
NT seq 393 nt   +upstreamnt  +downstreamnt
atgccatttttacatacttgtattcgcgttaaagatttggacgcctcaattgctttttat
caagaagcacttggttttaaggaagttcgtcgcaatgactttcctgaaaatcaatttact
ttagtctatatggccctagaggacgaccctagttacgaattagagttaacctataactat
gatcacgaagcttatgatttaggaaatgggtatggtcatattgctgttggtgtagacgat
ttggaaactacttatgatgcccatcagaaagcaggttactctgtaacaaaaatttctgga
ttaccaggtaaacctaatatgttctactttattcaagatccagatggctataaaattgaa
gttattcgactcaatcaatttaaagctgactaa

KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_1278
Entry
GBS222_1278       CDS       T02656                                 

Definition
(GenBank) glyoxalase family protein
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_1278
Enzymes [BR:sagl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     GBS222_1278
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_2
Other DBs
NCBI-ProteinID: CCO74962
LinkDB
Position
complement(1337082..1337459)
AA seq 125 aa
MISSIGQVMLYVSNVEASADFWKNKVGFERVEKQTQGDYVTYIVAPKLDSEVSFVLHDKA
IIAQMSPELDLATPSILFETTDIDSTYQELTANEVMTTPIVDMGSMRVFNFSDNDNNYFA
IREVK
NT seq 378 nt   +upstreamnt  +downstreamnt
atgatttcatcaattggacaggtaatgctctacgttagcaatgttgaagcatcagcagat
ttttggaaaaacaaggtgggttttgagcgtgttgaaaaacaaacacaaggagattatgta
acctatatagttgcaccgaagttggatagtgaagttagcttcgtcttacatgacaaagca
attatagctcaaatgagtcctgagctagatttagcaactccctctattttatttgaaact
actgatattgacagtacatatcaagaattaacagcaaatgaggttatgacaactcctatt
gttgatatgggaagtatgagagtttttaatttttctgataatgacaataattactttgca
atccgtgaagtaaaataa

DBGET integrated database retrieval system