KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_1339
Entry
GBS222_1339       CDS       T02656                                 

Definition
(GenBank) Putative acylphosphatase
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00620  Pyruvate metabolism
sagl00627  Aminobenzoate degradation
sagl01100  Metabolic pathways
sagl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_1339
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GBS222_1339
Enzymes [BR:sagl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     GBS222_1339
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-ProteinID: CCO75017
LinkDB
Position
1388957..1389235
AA seq 92 aa
MKKVHLIVSRRVQGVEFRYATYSLALEIGDIYGRVWNNDDGTVEILAQSTDSNKMTQFIQ
KIRKGPSKWSKVTYVDIKLDNFDDFNDFKMRN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaaaaggttcatttaattgtctcaaggcgcgttcaaggagtcgaatttcgctatgca
acttattccttagctttagaaataggtgatatttacggtcgcgtttggaataacgatgat
ggaactgttgaaattttagcacaatccacagattcaaataaaatgacacaatttattcag
aaaattcgaaaaggaccttcaaaatggtctaaagtaacttatgttgatattaaactagat
aacttcgatgattttaacgactttaaaatgaggaattaa

DBGET integrated database retrieval system