KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_1396
Entry
GBS222_1396       CDS       T02656                                 

Gene name
ppdK
Definition
(GenBank) Pyruvate Phosphate Dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00010  Glycolysis / Gluconeogenesis
sagl00620  Pyruvate metabolism
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01120  Microbial metabolism in diverse environments
sagl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBS222_1396 (ppdK)
   00620 Pyruvate metabolism
    GBS222_1396 (ppdK)
Enzymes [BR:sagl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     GBS222_1396 (ppdK)
SSDB
Motif
Pfam: PEP-utilizers_C PPDK_N PEP-utilizers H-kinase_dim HpcH_HpaI HTH_11
Other DBs
NCBI-ProteinID: CCO75071
LinkDB
Position
complement(1442495..1445140)
AA seq 881 aa
METKFVYHFDEGCKEMKELLGGKGANLAEMTSIGLPVPQGFTITTQACNDYYDNACHIRE
SILSQIDQAMAQLEVGQNKQLGSVDDPLLVSVRSGAVFSMPGMMDTVLNLGLNDRSVQGL
VKKTEDERFAYDSYRRFIQMFADVVTGIPKYKFDTILDRLKTDKCYQDDTELTGSDLKRL
VEFYKELYQKEAGEKFPQDPKRQLLLAIEAVFKSWNNPRAKIYRKLNDISETLGTAVNIQ
AMVFGNMGNNSGAGVAFTRNPSTGAANLFGEYLINAQGEDVVAGIRTPQSISKLAEQMPI
IYQEFVSVTQKLEAHYRDMQDMEFTIENGNLYMLQTRSGKRTAKAAIKIAVDQVNEGLIS
KEEAILRIEPKQLDQLLHPSFDLKSLKKAILLTTGLPASPGAAYGKVYFHAEDVVQEMKK
GNPVLLVRQETSPEDIEGMVSANGIITARGGMTSHAAVVARGMGKPCVAGCSQLLVDEVR
RENSIGHQTIKEGEMLSIDGATGNVYIGQVPMAETSVDRDFEIFMKWVDENRDMMVCSNA
DNPRDAQKALDFGAEGIGLCRTEHMFFDDERIPVVREMILADDVLSRRKALERLLSFQRD
DFYQIFKVLKGKTCTIRLLDPPLHEFLPHDKESIESMARQTGISTLAIEKRIQTLEEFNP
MLGHRGCRLAITYPEIYQMQVRALVQGAILAMKEGYEAKPEIMIPLVSAHEEISIIRDLI
EETIVEESKSKKINLSFPIGTMIETPRACMIADDIAKFADFFSFGTNDLTQMSFGFSRDD
AGKFLGEYVDKGLLKKDPFQVLDQKGIGKFIEQAVRLGKEVKPNLKIGICGEHGGEPSSI
EFCYQQGLHYVSCSPFRIPIAKLAAAQAKIKQSRNDITIDK
NT seq 2646 nt   +upstreamnt  +downstreamnt
atggaaactaagtttgtgtatcattttgatgaaggttgtaaggaaatgaaggaactgcta
ggtggtaagggggctaatctagctgaaatgacgagtattgggttaccggtaccacaaggt
tttactattacaacacaggcttgtaatgattattatgataacgcttgccatatccgagag
agtattcttagtcaaattgatcaagcaatggcacaattggaggttggacagaacaagcaa
ttaggaagtgttgatgatcctttgttggtgtcagttcggtcaggagcagttttttcaatg
cctggtatgatggatacagttttaaatttagggttaaatgatcgtagtgttcaaggttta
gtgaaaaaaacagaagacgagcgttttgcttatgacagttatcgtcgttttatccaaatg
tttgcagatgtggttacaggcattccaaaatataaatttgataccattttagatcgactt
aagacagataaatgttatcaagatgacacagaactaactggttcagatttaaagagactt
gttgaattttacaaagaactatatcaaaaagaagcaggagaaaaatttccgcaagatcct
aaaaggcagcttttgttagcaattgaggcagtttttaaatcatggaataatccaagagct
aagatttatcgtaaattaaatgatatttcggagacgcttggaacagccgttaatatccaa
gctatggtttttgggaatatgggaaataacagcggagcgggagttgcttttacacgaaac
ccatcaactggagcagcaaatttatttggtgagtatttgattaatgcacaaggagaagat
gttgttgcaggtatcagaacaccacaatccatatcaaaattggcagaacaaatgcctatt
atttaccaagagtttgtaagcgttacccaaaagttagaagctcattatcgcgatatgcaa
gatatggagtttacaattgaaaatggtaatctttatatgcttcagacgagaagcggtaag
cgtacagcgaaggcagctatcaaaatagcagtagatcaagtaaatgaaggcctaattagt
aaagaagaagctatactacgtatcgagcccaaacaattagatcagttattacacccttct
tttgacttgaaaagtttaaagaaagctattcttttgacgacaggacttccagcttctcct
ggagctgcttatgggaaagtttatttccatgcagaagatgttgttcaagagatgaaaaag
ggaaatccagtgctattggtcagacaagagacatcacctgaagatatcgaggggatggtt
agtgcaaacgggattataacagcaagaggcggaatgacttcccatgcggcagtagtagcc
agaggaatggggaaaccatgcgttgcaggctgtagtcaattattggttgatgaagtaaga
cgagaaaattctattgggcatcaaacgataaaagaaggtgagatgttatcaatcgatggt
gctacaggaaatgtttatataggacaagttccgatggcagagactagcgtagatcgtgat
tttgagatatttatgaaatgggtagatgaaaatcgagatatgatggtgtgttcaaatgca
gataatccgagagatgctcaaaaggccttggactttggagcagaaggaataggtctttgt
cgcacggaacatatgttttttgacgatgaacgtattccagtcgttagagaaatgatttta
gcagatgatgtattgagtcgaaggaaggctctagaaaggcttttatctttccaaagagac
gatttttatcaaatttttaaagtattgaaaggtaaaacttgtacgattcgtttgcttgac
cctcctttacatgaattcttaccccatgataaagagtctatagaatctatggcaagacaa
acggggatatctactttagctattgaaaaacggattcaaacattagaagaattcaaccct
atgttaggtcatcgtggttgtagacttgcgattacctatccggaaatttaccaaatgcag
gtgagagctcttgtacaaggcgctatacttgcaatgaaagagggatatgaggcaaagcca
gaaattatgattcctttagtgtcagcgcatgaagaaatctctataatacgtgatctgatt
gaagagacaattgttgaggagagtaaatctaaaaaaattaacttatcattccctattggg
acaatgattgaaacaccaagagcttgtatgatagcggatgatattgcaaagtttgcggat
ttctttagttttgggaccaatgatttaacacaaatgagctttggattttcacgagatgat
gctggaaaattcttaggagaatacgttgataaaggacttctaaaaaaagaccctttccaa
gttttagatcaaaaaggaataggaaagtttattgagcaggcagtgaggttaggaaaagaa
gttaagccaaaccttaaaataggtatctgtggagagcatggtggagaaccgtcatctatt
gagttctgttaccaacaggggttacattatgtatcgtgttcgccgtttagaattcctatt
gctaaattagcggctgcacaggctaaaatcaaacaaagtagaaatgatataacaatagat
aaataa

DBGET integrated database retrieval system