KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_1448
Entry
GBS222_1448       CDS       T02656                                 

Gene name
pflB
Definition
(GenBank) Pyruvate formate-lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00620  Pyruvate metabolism
sagl00640  Propanoate metabolism
sagl00650  Butanoate metabolism
sagl01100  Metabolic pathways
sagl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBS222_1448 (pflB)
   00640 Propanoate metabolism
    GBS222_1448 (pflB)
   00650 Butanoate metabolism
    GBS222_1448 (pflB)
Enzymes [BR:sagl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     GBS222_1448 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: CCO75120
UniProt: A0A0E1EPU5
LinkDB
Position
1499428..1501740
AA seq 770 aa
MATVKTNTDIFEQAWEGFKGVDWKEKASIARFVQANYAPYDGDESFLAGATERSLHIKKV
IEETKAHYEETRFPMDTRVASISELPAGFIDKDNELIFGIQNDELFKLNFMPKGGIRMAE
TTLKENGYEPDPAVHEIFTKYATTVNDGIFRAYTSNIRRARHAHTVTGLPDAYSRGRIIG
VYARLAVYGADYLMQEKVNDWNALNDIDEESIRLREEINLQYQALGEVVKLGDLYGVDVR
KPAMNTKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLDIFAERDLARGTFTESEIQEFV
DDFVLKLRTVKFARTKAYDALYSGDPTFITTSMAGMGADGRHRVTKMDYRFLNTLDNIGN
SPEPNLTVLWSDQLPYAFRRYCMSMSHKHSSIQYEGVSTMAKEGYGEMSCISCCVSPLDP
ENEDKRHNLQYFGARVNVMKALLTGLNGGYDDVHKDYKVFDIDPIRDEVLNFDTVKANFE
KSLDWLTDTYVDAMNIIHYMTDKYNYEAVQMAFLPSHVRANMGFGICGFANTVDSLSAIK
YATVKPIRDEDGYIYDYETVGDFPRYGEDDDRVDSIAEWLLEAFHGRLAKHKLYKDAEAT
VSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSVNLSKVEFFSPGANPSNKAKGGWLQNLN
SLSKLDFAHANDGISLTTQVSPRALGKTFDEQVDNLVTVLDGYFENGGQHVNLNVMDLKD
VYDKIMNGEDVIVRISGYCVNTKYLTPEQKTELTQRVFHEVLSMDDALTN
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcaacagttaaaacaaacacagatatctttgaacaagcttgggaaggctttaaaggt
gttgattggaaagaaaaagcaagtattgctcgcttcgttcaagcaaactatgcaccttac
gatggagatgaaagcttcttagctggagcaacggaacgttcacttcacatcaaaaaagtg
attgaagaaacaaaagctcactatgaagaaactcgcttcccaatggatactcgtgttgct
tcaatttctgaattaccagctggttttatcgacaaagataacgaacttatctttggtatt
caaaacgacgagcttttcaaattgaacttcatgcctaaaggtggtatccgtatggcggaa
actacacttaaagaaaatggttatgaacctgatccagctgttcacgaaatcttcactaag
tacgctacaacagtaaatgatggtatcttccgcgcttatacttctaacattcgtcgtgct
cgccatgcacacactgttactgggcttccagacgcttattcacgcggacgtatcattggt
gtatatgctcgtctagctgtttacggtgctgactacttgatgcaagaaaaagttaatgac
tggaatgcattgaatgatattgatgaagagtcaattcgtcttcgtgaagaaatcaacctt
caataccaagctcttggtgaagttgtaaaacttggtgacctttacggcgtagatgttcgt
aaaccagccatgaacactaaagaagccattcaatgggttaacattgctttcatggctgta
tgtcgtgttatcaatggtgctgcaacatcacttggacgtgttcctattgtccttgatatc
tttgcagaacgtgacctcgctcgcggtacattcacagaatcagaaatccaagaatttgtt
gatgattttgtccttaaactccgtactgtaaaatttgctcgtactaaagcttatgatgcc
ctttactcaggtgacccaacctttatcacaacttcaatggcaggtatgggagctgatgga
cgtcatcgtgttaccaaaatggactatcgtttcttaaatacacttgacaatatcggtaac
tcaccagaaccaaacttaactgttctttggtcagaccaattaccatatgctttccgtcgc
tactgtatgtcaatgagtcataaacactcttcaatccaatatgaaggtgtatcaacaatg
gctaaagaaggctacggtgaaatgtcatgtatttcatgttgtgtatctccacttgatcca
gaaaacgaagacaaacgtcacaacctccaatattttggtgctcgtgttaacgttatgaaa
gcacttcttactggtcttaacggtggttatgatgatgttcataaagattacaaagtattt
gacatcgacccaattcgtgacgaagtactcaactttgacactgtaaaagctaactttgaa
aaatctcttgattggttgactgatacttatgttgatgcgatgaatatcatccactacatg
actgataaatacaactatgaagctgtacaaatggcattcttaccttcacatgtacgtgct
aatatgggatttggtatctgtggttttgcaaatactgtcgattcattatctgcgattaaa
tacgctactgttaaaccaatccgtgacgaagatggttacatctacgactacgaaacagtt
ggtgacttcccacgttatggtgaagatgatgatcgtgttgactcaatcgctgaatggtta
cttgaagccttccatggacgccttgctaaacacaaactttataaagatgctgaagcaact
gtttctcttcttacaatcacatcaaacgttgcttactctaaacaaactggtaactcaccg
gtacataaaggagtatatctcaatgaagatggtagtgtaaacctttctaaagtagaattc
ttctcaccaggtgctaacccttctaacaaagctaaaggtggctggttacaaaacttgaat
tcactttctaaacttgatttcgctcatgcaaatgatggtatttcattgacaactcaagtt
tctccacgcgctcttggtaaaacatttgatgaacaagttgataacttggtaacagtcctt
gatggttactttgaaaacggtggtcaacacgttaacttgaatgtcatggaccttaaagat
gtctatgacaagattatgaatggtgaagatgttatcgttcgtatctcaggttactgtgtc
aatactaaatatctaactcctgagcaaaaaactgagttaacacaacgtgtcttccatgaa
gtactttcaatggacgatgcattaactaactag

DBGET integrated database retrieval system