KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_1460Help
Entry
GBS222_1460       CDS       T02656                                 

Gene name
cydC
Definition
(GenBank) cytochrome D ABC transporter ATP binding and permease protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sagl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GBS222_1460 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sagl02000]
    GBS222_1460 (cydC)
Transporters [BR:sagl02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    GBS222_1460 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 ABC_membrane RsgA_GTPase DUF87 AAA_29 AAA_16 MMR_HSR1 AAA_18 AAA_25 AAA_22 FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: CCO75132
LinkDB All DBs
Position
complement(1512274..1514022)
Genome map
AA seq 582 aa AA seqDB search
MFKIPLFKELKTDQWVKPFFKQYKVSLVIALFLGFMTFFSASALMFNSGYLISKSASLPS
NILLVYVPIVLTRAFGIGRPVFRYIERLTSHNWVLRMTSQLRLKLYHSLESNAIFMKRDF
RLGDVMGLLAEDINYLQNLYLRTIFPTIIAWILYSFIIIATGFFSLWFALMMLLYLAIMI
FVFPLWSILANGARQTREKELKNHLYTDLTDNVLGISDWIFSQRGQEYVALHERSESELM
AVQKKIRSFDNRRALIVELVFGFLAILVIIWASNQFIGHRGGEANWIAAFVLTVFPLSEA
FAGLSAAAQETNKYSDSIHRLNELSEMYFETTQNQLPNKPYDFSVKNSSFQYKPQEKWVL
HHLDLDIKEGEKIAILGRSGSGKSTLASLLRGDLKASQGEITLGGADVSIVGDCISNYIG
VIQQAPYLFNTTLLNNIHIGNQDASEEDVWKVLERVGLKEMVTDLSDGLYTMVDEAGLRF
SGGERHRIALARILLKDVPIVILDEPTVGLDPITEQALLRVFMKELEGKTLVWITHHLKG
IEHADRILFIENGQLELEGSPQELSQSSQRYRQLKAADDGDL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatccctttgtttaaagaattaaagacagatcaatgggtaaaaccatttttc
aaacaatataaagtttccttagtaattgctcttttccttggttttatgactttcttttct
gccagtgctcttatgtttaattcgggctatctgattagtaagtcagcttcactaccgagt
aatattcttctagtatatgttccaattgtactaacacgtgcttttggtattggacgtcct
gtttttcgttatatagaacgcctaacgagtcacaattgggtattacgaatgacttcacaa
ctgcgcttgaagctttaccattccttagaaagcaatgctatctttatgaagcgtgatttt
cgtttaggagatgttatggggcttttagcggaggatattaattatttgcaaaatttgtat
cttaggacaatatttccaacgattatagcgtggatattatatagctttattattattgca
acaggcttcttttctctatggttcgctttaatgatgttgctttatttagctattatgatt
tttgtttttccactttggtcgattttagctaatggtgctcgtcagactcgtgaaaaagaa
ttaaaaaatcatctttatactgatttgacggataatgtcttaggtatttcagactggatt
tttagtcaacgtggtcaagagtacgtcgccttgcatgaacgttcggaaagtgaactcatg
gctgttcagaaaaaaattcgttcctttgataatcgtagagctcttattgtggaattagtt
tttggctttctagccattttggttattatttgggctagtaatcagtttattggtcacaga
ggtggcgaagctaactggattgcagcatttgttctaacagtatttcccttgtcagaggca
tttgctggtttgtctgctgctgctcaagaaacaaataaatattctgattcaattcatcgt
cttaatgaattatcagaaatgtattttgaaacaactcaaaatcaattgcctaataagcca
tacgatttttccgtcaagaattcaagtttccagtataagccacaagagaaatgggttttg
catcatttagatttggatattaaagaaggagaaaaaattgctattttagggcgtagtggt
tctggcaagagtaccttagctagtctacttcgtggcgacttgaaagcaagtcaaggggag
attaccctaggcggtgctgatgtttcaatagttggtgattgcatttctaactatattgga
gtgatacaacaagcgccctacctttttaatacaaccctgctaaataacattcacattgga
aaccaagatgctagtgaagaagatgtatggaaagttcttgaacgagttggattgaaagag
atggtcactgatttatcagatggtctctatacaatggttgatgaagctggacttaggttt
tcaggtggcgaaaggcatagaattgctttggctagaatcttactaaaagatgtcccaatt
gttatcttagatgagccaactgttggacttgatcctattactgaacaagccttactaagg
gtatttatgaaagaattggaaggtaagaccttagtttggattacacatcacttaaaaggt
attgaacatgctgatcgtatcttatttatagaaaatgggcaattagagttggaaggttct
cctcaagaattgtctcaaagtagccaacgttaccgtcagctgaaagccgctgatgatggt
gatctatga

DBGET integrated database retrieval system