KEGG   Streptococcus agalactiae 09mas018883: BSA_5520Help
Entry
BSA_5520          CDS       T02703                                 

Definition
(GenBank) Para-aminobenzoate synthase, amidotransferase component
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sagm01100  Metabolic pathways
sagm01110  Biosynthesis of secondary metabolites
sagm01130  Biosynthesis of antibiotics
sagm01230  Biosynthesis of amino acids
sagm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sagm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSA_5520
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BSA_5520
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSA_5520
Enzymes [BR:sagm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BSA_5520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: CCW37325
LinkDB All DBs
Position
484620..485186
Genome map
AA seq 188 aa AA seqDB search
MLLLVDNYDSFTYNLKQYLSVYKEIFVIKNDDPNLFLLAESAEAIVLSPGPGHPKDAGKM
LELINQFIGKKPILGICLGHQALAECLGGRLNLANHVMHGKQSWVTINDHTSLFKGIDSP
TQVMRYHSLVVTDLPENIAVIARSNEDNEIMAFHCPSLKVYAMQFHPESIGSIDGMKMIE
NFLTLIND
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgttactattggtagataattacgattcttttacctataatttaaagcaatatttaagt
gtctataaagagatattcgtcataaaaaatgatgatcctaacctttttttattagctgag
agcgcagaagccatcgtcttatcacctggaccaggacacccaaaggatgctgggaaaatg
ttagaattaatcaatcagtttataggaaagaaacctattctaggtatctgtttggggcat
caagcgcttgctgagtgcttgggtgggcgattaaatttagcaaatcacgttatgcatggt
aaacaaagttgggtaacaataaacgaccatactagtttgtttaagggaattgatagtcca
acccaagttatgcgttatcactcattggtagtgactgatttaccagagaatattgctgtt
attgcacgatcaaatgaggataatgaaatcatggcattccattgccccagcttaaaggta
tatgcgatgcagtttcatcctgagtcaatcgggagtattgatggaatgaaaatgattgaa
aactttttgacgttaattaatgactaa

DBGET integrated database retrieval system