KEGG   Streptococcus agalactiae 09mas018883: BSA_7870Help
Entry
BSA_7870          CDS       T02703                                 

Definition
(GenBank) 2-dehydro-3-deoxygluconate kinase
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00030  Pentose phosphate pathway
sagm01100  Metabolic pathways
sagm01120  Microbial metabolism in diverse environments
sagm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSA_7870
Enzymes [BR:sagm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     BSA_7870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: CCW37559
LinkDB All DBs
Position
721407..722432
Genome map
AA seq 341 aa AA seqDB search
MAKIISLGEVLLRLSPPQYHTLMQANHLKCQFGGSELNVLASLAQLGHHVGLVSALPDND
LGKMARQFILSQQISPAAIIKKEGRLGIYYYEQGFSVRTNKVIYDRNYSSFWESTLSDYD
FTSIFKGVDWFHVSGITPALTKDLYEVTRFLMTKAKEGGVKVSIDLNFRESLWSSFQEAR
EQLSPLLGLSDVCFGLEPIYLAGESEDLKDELGLSRPYLDIELLEKITQKIVQEYGLDYI
AFTQREMGYTNQYMLKSYLYHNNMLYQTDKTGVEVLDRVGTGDAFAAGLIHALLEKETPQ
RALEIAMTTFKYKHTIQGDINIMTRDDIAYLIEKETNDIKR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattatttcattaggtgaggttcttttgcgattatctccacctcaatatcac
acactgatgcaggctaatcacctaaaatgccaatttggtggttcagaacttaatgtctta
gcaagccttgctcaactaggtcaccatgtaggattagtctcagctttgcctgataatgat
ttgggtaagatggcaagacaatttatattgtcacagcaaattagtccagctgctataatt
aaaaaagaaggacgactaggaatttattattatgaacaaggattttcggtaagaacaaat
aaggttatctacgatcgtaactattcatctttttgggaaagtaccttgagtgattatgat
tttacttctatttttaagggagtggattggtttcatgtttctggaattactccagcacta
accaaggacttatatgaggtgactcggttccttatgacaaaagctaaagaaggaggtgta
aaagtatcgattgatctcaattttcgtgagagtttatggtcatcttttcaagaggcgcgt
gagcaattatcgccactattaggattatcagatgtttgctttggcttagagccgatttat
ttagctggtgaaagtgaagatttaaaagatgagttgggcttatccagaccttaccttgat
attgaattacttgaaaagataactcaaaagattgttcaagaatatgggttagactatatt
gcctttactcaaagggaaatgggatatactaatcagtatatgttaaaatcatatttgtat
cataataatatgttatatcaaactgataaaactggcgttgaagtattagatcgtgtgggg
acgggagatgcctttgctgcaggtttaattcatgcgcttctggaaaaagaaactcctcaa
agggccttagaaattgctatgactacatttaaatacaaacataccattcaaggagatatc
aatatcatgacacgagatgatattgcttacctcattgaaaaagaaacaaatgatattaaa
cgatag

DBGET integrated database retrieval system