KEGG   Streptococcus agalactiae 09mas018883: BSA_8490Help
Entry
BSA_8490          CDS       T02703                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
sagm00620  Pyruvate metabolism
sagm00680  Methane metabolism
sagm01100  Metabolic pathways
sagm01120  Microbial metabolism in diverse environments
sagm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSA_8490
  Energy metabolism
   00680 Methane metabolism
    BSA_8490
Enzymes [BR:sagm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BSA_8490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3288
Motif
Other DBs
NCBI-ProteinID: CCW37621
LinkDB All DBs
Position
785155..787950
Genome map
AA seq 931 aa AA seqDB search
MSHPKLESSSNKEIITEEVGLLKQLLDEATQKLIGSESFDKIEKIVSLSLTDDYTGLKET
ISALSNEEMVIVSRYFSILPLLINISEDVDLAYEINYKNNLNQDYLGKLSTTIDVVAGHE
NAKDILEHVNVVPVLTAHPTQVQRKTVLELTSKIHDLLRKYRDVKAGIVNQEKWYADLRR
YIGIIMQTDTIREKKLKVKNEITNVMEYYNRSLIKAVTKLTAEYKALAAKKGIHLENPKP
LTMGMWIGGDRDGNPFVTAETLRLSAMVQSEVIINHYIEQLNELYRNMSLSINLTEVSPE
LVTLANQSQDNSVYRENEPYRKAFNFIQDKLVQTLLNLKVGSSPKEKFVSRQESSDIVGR
YIKSHIAQVASDIQTEELPAYATAEEFKQDLLLVKQSLVQYGQDSLVDGELACLIQAVDI
FGFYLATIDMRQDSSINEACVAELLKSANIVDDYSSLSEEEKCQLLLKELTEDPRTLSST
HAPKSELLQKELAIFQTARELKDQLGEDIINQHIISHTESVSDMFELAIMLKEVGLIDAN
QARIQIVPLFETIEDLDNSRDIMTQYLHYELVKKWIATNNNYQEIMLGYSDSNKDGGYLS
SGWTLYKAQNELTKIGEENGIKITFFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTE
QGEIIENKYGNQDAAYYNLEMLISASIDRMVTRMITNPNEIDNFRETMDGIVSESNAVYR
NLVFDNPYFYDYFFEASPIKEVSSLNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFP
GWYGVGSAFKHFIEQDEANLAKLQTMYQKWPFFNSLLSNVDMVLSKSNMNIALQYAQLAG
SKEVRDVFNIILNEWQLTKDMILAIEQHDNLLEENPMLHASLDYRLPYFNVLNYVQIELI
KRLRSNQLDEDYEKLIHITINGIATGLRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccacccgaaattagaaagtagtagcaataaagaaatcattaccgaagaggtcggt
ttactgaagcagcttttggatgaagcaacgcaaaaattgattggtagtgaatcatttgac
aagattgaaaaaatagtttcattatcattaactgacgattatactggtctgaaggaaact
atttcggctttaagcaacgaggagatggttattgtttctcgttacttctctattttgccg
ctcttaattaatatttcagaagacgttgatttagcatatgaaattaattataaaaataat
cttaaccaagattacctaggaaagttatcaacgactattgatgttgtagctggccatgaa
aatgctaaagatattcttgaacacgtcaatgttgtgcctgtgctaacagctcatcctact
caggtgcagcgtaaaacggtgctcgaattaacgtctaagattcatgatttattacgtaaa
tacagagatgtcaaggcaggaatcgtgaatcaagaaaaatggtatgctgacttgcgtcgt
tacatcggcattatcatgcaaacagacactattcgcgagaaaaaattgaaagtcaaaaat
gagataaccaatgtaatggaatattacaaccgttctcttattaaagcagttaccaaatta
acagcagaatataaggcactggcagctaaaaaaggtattcacttggagaatcctaagcct
ctgactatggggatgtggattggtggtgatagagatggcaatccctttgtaactgctgag
acactaagattatcagctatggtacaaagtgaagtgattattaaccattatattgagcag
ctaaatgaactttatcgtaatatgtcactttcaataaatctaactgaagtctctcccgaa
cttgttacattggcaaaccagtcacaagataattcggtatatagggaaaatgaaccttac
cgtaaagctttcaattttatccaagataaactggtacaaaccctactaaatttaaaagtt
ggttcttccccaaaagagaaatttgttagtcgccaagaatcttctgatattgtaggaagg
tatataaaatcacatatcgctcaagtagcttctgacatacagacagaagaactaccagca
tacgctactgctgaggagtttaaacaagatttgttacttgtgaagcaatctttagttcaa
tatggacaagattctcttgttgatggcgaattagcttgtcttattcaagcagtagatatc
tttggattttatttagctactattgatatgcgtcaagattctagtattaatgaagcttgt
gtagcagaattattgaagtctgccaatattgtagatgattacagttctctttcagaagaa
gaaaaatgtcaacttctcttaaaagaattaacagaagatcctagaacattatcttctacg
catgctcctaaatccgagttacttcaaaaagaattggctattttccaaacagcacgtgag
ttaaaagatcaattgggtgaagacattataaaccagcatatcatttctcacacagagagc
gtttcggatatgtttgagttagctatcatgttaaaagaagttggactaattgatgccaat
caagctcgtattcagattgtaccgttatttgaaaccatcgaagatttggataattcacgt
gatattatgacccagtatctacattatgaattagttaaaaaatggattgctactaacaac
aattatcaagaaataatgctaggttattcagatagtaataaagatggtggctatttatca
tctggttggactctatataaagctcaaaatgagctaacaaaaataggtgaagaaaacggt
attaaaatcacatttttccacggtcgtggtggaactgttggtcgtggtggtggtccatct
tatgaagctatcacatcacaaccttttggttcaatcaaagatcgaattcgcctaacagag
caaggtgaaatcattgagaataaatatggtaatcaagatgcagcctattataaccttgaa
atgcttatttcagcttccatagaccgcatggtaacacgtatgattactaaccctaatgaa
attgataatttccgtgagacaatggatggtattgtgtctgaaagtaatgccgtttataga
aatttagtttttgataatccttatttctatgactatttctttgaagcaagtccaattaaa
gaggtatcaagtttaaatattggttctcggccagcagcacgtaaaacaattacagaaatt
tcaggtttacgtgcaattccatgggtattttcatggtcacaaaatcgtattatgtttcca
ggatggtatggtgttggatcagccttcaagcactttattgaacaagatgaggcaaactta
gcaaaattacaaaccatgtatcaaaaatggccattctttaattctcttttatctaatgta
gatatggttttatcaaaatcaaatatgaatattgcgcttcagtatgctcagttagctgga
agtaaagaagttcgagatgtttttaatatcatccttaatgaatggcagttaactaaagat
atgattttagctattgaacagcatgataatttattagaagaaaacccaatgttacatgca
agtttagattatcgtttgccatatttcaatgttttgaattatgttcaaattgaattgatt
aaacgtcttcgtagtaaccaactagatgaagactatgagaagttgattcatattactatt
aatggtattgcaacaggtttacgaaattcaggttaa

DBGET integrated database retrieval system