KEGG   Streptococcus agalactiae CNCTC 10/84: W903_0794Help
Entry
W903_0794         CDS       T03518                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sagn  Streptococcus agalactiae CNCTC 10/84
Pathway
sagn00500  Starch and sucrose metabolism
sagn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    W903_0794
Enzymes [BR:sagn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     W903_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AIX04484
LinkDB All DBs
Position
702251..703717
Genome map
AA seq 488 aa AA seqDB search
MTNELIMQAFEWYLPSDGNHWKKLEESISDLKKLGISKIWLPPAFKGTSSDDVGYGVYDL
FDLGEFDQNGTIRTKYGRKEEYLKLIKSLKANGIKPFADIVLNHKANGDHKEKFQVIKVN
PENRQEALSEPYEIEGWTGFDFPGRQGEYNDFKWHWYHFTGLDYDAKNNETDIFMIVGDN
KGWADDDLIDDENGNFDYLMYNDIDFKHPEVIKNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFINDIRTKIKPDLEVFGEYWKSDQTSMKDYLEATQFQFSLVDVTLHMNFFDASH
QNRDFDMRTIFDDSLVIDNPEYAVTFVENHDTQSGQALESRVEDWFKPLAYGLILLRQQG
TPCLFYGDYYGIQGEFGQPSFKEVIDKMAELRQNYVFGEQVDYFTHSNCIGWTCLGDEEH
NSCLAVVLTNGDQGWKHMEVGEIYAGKTFVDYLGNCEQEVVIGDDGWGDFLVASASISAW
VPKIEEAN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaattgataatgcaagcttttgagtggtatttacctagtgatgggaatcac
tggaagaaattagaggagtctatatcagaccttaaaaaacttggaattagtaaaatctgg
ttaccaccagcatttaagggaactagcagtgatgatgtaggatatggtgtttatgatctc
tttgatttaggagaatttgaccagaatggaacaattagaacaaaatatggtagaaaagaa
gagtatctaaagcttattaagtcgttaaaggcaaatggcattaaaccgtttgcagatatc
gttcttaaccataaagccaatggtgatcataaagaaaaatttcaagtcatcaaagtcaat
cctgaaaatcgtcaagaagcattaagtgaaccctatgagattgaaggatggacgggattt
gatttcccaggtagacagggtgagtacaatgattttaaatggcactggtaccactttact
ggtttagattacgatgctaaaaataatgaaacagacatctttatgattgtaggcgataat
aaaggttgggcagacgatgatttgattgatgatgaaaatggtaatttcgattatctcatg
tacaatgacattgattttaagcatcctgaagttataaaaaacttacaagattgggctaag
tggtttattgaaactacaggcattgaaggttttcgtttggatgctgtgaaacatatcgat
tcttactttattcaaactttcattaatgatattcgtacaaaaataaaacccgatttagag
gtctttggcgaatattggaaatctgaccaaacatcaatgaaggactatttagaggcaaca
caatttcaattttctcttgttgatgtcaccttgcatatgaatttttttgatgccagtcac
caaaaccgtgattttgatatgcgaacaatttttgatgatagtcttgttattgataatcct
gagtatgctgttacattcgtagaaaatcacgatacgcaaagtggacaagctctagaaagt
agagtggaagattggtttaaacctttagcttatggcttgatacttttacgccaacaaggg
actccatgtcttttttatggtgattactatggcattcaaggagaatttggccaaccatcc
tttaaagaggttattgataaaatggctgagctacgccaaaactatgtatttggcgaacaa
gtcgattactttacgcattcaaattgtattggttggacttgtcttggggatgaggaacat
aattcttgtttagctgtggtcctaacaaatggtgatcagggatggaaacatatggaagta
ggggaaatttatgcaggcaaaacttttgttgattatttaggcaattgtgaacaagaggtt
gttataggagatgatggttggggtgattttttagttgcatctgcgtctatctcggcttgg
gtccctaaaatagaggaagctaactga

DBGET integrated database retrieval system