KEGG   Streptococcus agalactiae CNCTC 10/84: W903_0880Help
Entry
W903_0880         CDS       T03518                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sagn  Streptococcus agalactiae CNCTC 10/84
Brite
Enzymes [BR:sagn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     W903_0880 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIX04568
LinkDB All DBs
Position
790776..791384
Genome map
AA seq 202 aa AA seqDB search
MAIILPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADV
SQIPEDIRQAVINNGGGHLNHALFWELMSPEETQISQELSEDIDATFGSFEDFKAAFTAA
ATGRFGSGWAWLVVNAEGKLEVLSTANQDTPIMEGKKPILGLDVWEHAYYLNYRNVRPNY
IKAFFEIINWNKVNELYQAAKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttaccagatttaccctatgcatatgatgcgcttgagccacatattgat
gctgagacaatgacactacatcatgataagcaccatgcaacttatgttgctaatgcaaat
gctgctcttgagaaacatcctgaaattggagaagacttagaagcgctcttagctgatgtt
tctcaaattccagaagatattcgtcaggcagtcatcaataacggtggtggacatcttaac
cacgctcttttctgggaattgatgtcaccagaagaaactcaaatttcacaagagttatct
gaagacattgatgcaacttttggttcatttgaagactttaaagctgctttcacagcagca
gcaacaggacgttttggttcaggttgggcttggcttgttgttaatgctgaaggcaaactt
gaagtgctttcaactgccaatcaagatactccaattatggaaggtaagaaacctatttta
gggcttgatgtatgggagcatgcttattacttaaactatcgtaatgttcgtcctaactac
atcaaagctttctttgaaattattaactggaataaagtaaatgaactttaccaagctgct
aaagcttaa

DBGET integrated database retrieval system