KEGG   Streptococcus agalactiae CNCTC 10/84: W903_1497Help
Entry
W903_1497         CDS       T03518                                 

Definition
(GenBank) multidrug resistance family protein
Organism
sagn  Streptococcus agalactiae CNCTC 10/84
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 MFS_4
Motif
Other DBs
NCBI-ProteinID: AIX05167
LinkDB All DBs
Position
complement(1438781..1439950)
Genome map
AA seq 389 aa AA seqDB search
MAWLGNFFTGASFSLVMPFMVLYVEQLGAPSNKVEWYAGLSVSLSALSSALVAPLWGRLA
DKYGRKPMMVRAGLMMTFTMGGLAFIHSVTGLLILRILNGIFAGYVPNSTALIASQAPQE
ESGYALGTLATGVTGGMLIGPLLGGLLAEWFGIREVFLLVGTILLISTLMTIFMVKEDFK
PISNEETMPTTEVFKSVKSLQILIGLFVTSMIIQISAQSIAPILTLYIRHLGQTENLMFV
SGLIVSGMGFSSILSSPKLGRIGDRMGNHRLLLLALLYSFLMYVLCSLAQTSLQLGVIRF
LYGFGTGALMPSINSILTKIAPRQGLSRIFSYNQMFSNLGQVLGPFVGSAVSIHLGFRWV
FFVTSFIVLANFVWCFINFRKYIRVKEIV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggcttggctcggtaatttttttactggggcaagcttttcacttgttatgccttttatg
gtattatatgtagaacaattaggagcacctagcaacaaagtagagtggtatgcaggctta
tcagtatccttatcagccttgtcttcagctttagttgccccattatgggggcgcttagct
gataaatatggtagaaaaccgatgatggtaagagcagggttgatgatgacttttactatg
ggaggtcttgctttcattcatagtgttacaggacttctgattttacgtatattaaacggc
atttttgcaggctatgtacctaactctacagctttgatagcaagtcaagctcctcaagag
gaatcaggatatgccttaggaactttagcgacaggagtgactggaggtatgttaattggt
ccacttttagggggacttttagcagagtggtttggtattagggaagtttttttattagtg
ggaaccatattgttaatatctactttaatgaccatttttatggtaaaggaagatttcaaa
cccatttctaacgaagaaaccatgccaactacagaagtgttcaaaagcgttaaaagctta
caaattttaatagggctgtttgtaacaagcatgattattcaaatttctgcacaatcaatt
gcacctattttaacactttacattcgtcatttaggacagactgaaaacttgatgtttgtt
tccggattaattgtttctggtatgggattctctagtattctgagtagtccaaagctagga
agaatcggggatcgcatgggcaatcatcgtttactattattagctctactgtatagtttc
ctcatgtatgtcttatgttcattggcacagacttcattacagttaggggttattagattc
ctgtatggttttggaacaggtgccttgatgccgagtattaattcaatcttgactaaaatt
gctccaagacaaggtttatcaaggattttcagttataaccaaatgtttagcaatttagga
caagtattaggtccttttgtcggttcagcagtttctattcatttaggattccgatgggtt
ttctttgtgactagcttcatcgttttagctaattttgtttggtgttttattaattttaga
aaatatattagagttaaggaaattgtgtga

DBGET integrated database retrieval system