KEGG   Streptococcus agalactiae CNCTC 10/84: W903_1824Help
Entry
W903_1824         CDS       T03518                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sagn  Streptococcus agalactiae CNCTC 10/84
Brite
KEGG Orthology (KO) [BR:sagn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    W903_1824 (ahpF)
Enzymes [BR:sagn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     W903_1824 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 NAD_binding_7 Lycopene_cycl Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AIX05490
LinkDB All DBs
Position
1755404..1756936
Genome map
AA seq 510 aa AA seqDB search
MVLDKEIKAQLAQYLDLLESDIVLQADLGDNDNSQKVKDFLDEIVAMSDRISLESTHLKR
QPSFGIAKKGQESRVIFSGLPMGHEFTSFILALLQVSGRAPKVDEDIIKRIKGIEKTINL
ETYVSLTCHNCPDVVQAFNIMAVLNPNITHTMIEGGMYQDEVKSKGIMSVPTVYKDQEEF
TSGRATIEQLLEQLDGPLDAEAFADKGVYDVLVIGGGPAGNSAAIYAARKGLKTGILAET
FGGQVIETVGIENMIGTLYTEGPKLMAQIEEHTKSYDIDIIKSQLATGIEKKELVEVTLA
NGAILQAKTAILALGAKWRNINVPGEEEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGM
EAALDLAGVTKHVTVLEFLPELKADQVLQERAAKTDNLTILKNVATKDIVGEDHVTGLNY
TDRDTNEEKHIDLEGVFVQIGLVPSTSWLKDSGIELNERQEIVVDKFGSTNIPGIFAAGD
CTDAAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtcttagataaagaaatcaaggctcaattagcgcaatatttagatttgctagaatct
gatattgtattacaagctgatttaggagataacgataattctcaaaaagtaaaggatttt
ctagatgaaattgtcgctatgtctgatcgcatcagccttgaatcaacacatttaaaacgt
caacctagttttgggattgcaaaaaaagggcaagaaagtcgcgttattttttcaggcttg
ccaatggggcatgaattcacatctttcattttagctttgttgcaagtctctggtcgcgca
ccaaaagttgatgaagacattatcaaacgaattaaggggattgagaaaactatcaatcta
gaaacttatgtttcattaacttgccataattgtccagatgtcgttcaagcctttaatata
atggctgttttgaatccgaatatcactcatactatgattgaaggaggcatgtatcaagac
gaagtcaaatcaaaaggcatcatgtctgttcctactgtttataaggaccaagaagaattt
acttctggccgtgctacaattgaacagcttttagaacaactagatgggcctcttgatgct
gaagcatttgctgacaaaggtgtctatgatgttctagttattggtggtggtcctgcaggt
aacagtgctgcaatttatgccgctcgtaaagggttaaaaacaggtattttagcagaaact
tttggtggacaagttatcgaaacagttggtattgagaacatgattggtacactgtacacc
gaaggccctaaattaatggctcaaattgaagagcataccaaatcttacgatattgatatt
atcaagagtcaattagcaactggcattgagaaaaaagaattagttgaggtaacactggct
aacggagctattttacaagctaaaactgctatcctagctctgggtgctaagtggcgaaat
atcaacgttcctggcgaggaagaattccgcaataaaggtgttacttactgtccacattgt
gatggccctcttttcgaaggaaaagatgttgctgttataggtggtggtaattcaggtatg
gaagctgctttagatctagccggtgtcactaaacatgttacagtcctagaattcttacct
gagctcaaagcagaccaagtactgcaagaaagagcagctaaaactgacaatttaactatt
cttaagaatgttgctactaaagatatcgttggtgaagatcatgtcactggtttaaactat
accgatcgtgatacaaacgaagaaaaacacattgatttagaaggtgtttttgtacaaatt
ggtcttgtaccaagtacatcttggctcaaggatagcggcattgaactcaatgaacgtcaa
gaaattgtcgttgataaatttggctcaacaaatatccctggtatttttgctgcaggtgac
tgtacagatgctgcctacaagcaaatcattatttccatggggtctggtgccacagctgcc
attggcgcatttgattatttaatcagacaataa

DBGET integrated database retrieval system