KEGG   Streptococcus agalactiae 138P: V193_01940Help
Entry
V193_01940        CDS       T03183                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
sagp  Streptococcus agalactiae 138P
Pathway
sagp00330  Arginine and proline metabolism
sagp01100  Metabolic pathways
sagp01110  Biosynthesis of secondary metabolites
sagp01130  Biosynthesis of antibiotics
sagp01230  Biosynthesis of amino acids
Module
sagp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sagp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    V193_01940
Enzymes [BR:sagp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     V193_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH GFO_IDH_MocA NAD_binding_2 2-Hacid_dh_C Rossmann-like IlvN DapB_N PDH
Motif
Other DBs
NCBI-ProteinID: AHN29977
LinkDB All DBs
Position
complement(344304..345074)
Genome map
AA seq 256 aa AA seqDB search
MKIGIIGVGKMASAIIQGLKQTQHDIVISGSCLERSKEIAERLDVTYAESHQSLINQADI
IMLGIKPQLFEKVLLPLDITKPIISMAAGISLARLSQLTRSDLPLIRIMPNINAQILQSC
TAICYNNHVSDELRQLAKEITDSFGSNFVIAETNFDTFTALAGSSPAYIYLFIEALAKAG
VKYGFPKEQALSIVGQTVLASSQNLLQGQNSTSDLIDNICSPGGTTIAGLLDLEKNGLTH
SVISAIDATIEKAKKL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaattatcggcgttggaaaaatggccagtgcaattattcaaggcctcaaa
caaacccaacatgacattgtcatatccggatcttgcttagagcgttcaaaagaaattgca
gaaagacttgatgttacttacgccgaatctcatcagtcattaatcaatcaagctgatatt
atcatgttaggtattaaacctcaactatttgaaaaggttcttcttccacttgatatcaca
aaaccaatcatctcaatggcagcaggaatctccttggcgcgtttaagccaattaactcgt
tctgatttaccattgattcgtattatgccaaatattaacgcacaaatacttcaaagttgc
acagctatttgttacaacaatcatgtatcggatgagttacgacaattagccaaagaaatt
acggatagtttcggaagtaactttgttatagcagaaaccaattttgataccttcactgct
ctagcaggttctagccctgcctatatctatctatttatagaagccttagctaaagcaggt
gtaaaatatggatttccaaaagaacaagcactctctattgtaggacagactgtcttagct
tctagtcaaaacctattacaaggacaaaatagcacctctgacttaatcgacaacatttgt
agcccaggcggaactactattgctggccttttagacttagaaaaaaatggtctgacgcat
agtgttatttctgccattgatgctactattgagaaagcaaaaaaactttga

DBGET integrated database retrieval system