KEGG   Staphylococcus agnetis: EP23_02090Help
Entry
EP23_02090        CDS       T04155                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sagq  Staphylococcus agnetis
Brite
KEGG Orthology (KO) [BR:sagq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sagq01001]
    EP23_02090
Enzymes [BR:sagq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EP23_02090
Protein kinases [BR:sagq01001]
 Serine/threonine kinases: Other
  Bacterial family
   EP23_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal Kdo RIO1 Kinase-like Seadorna_VP7 FTA2 Zn_peptidase_2 Choline_kinase Fructosamin_kin ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: ALN76233
UniProt: A0A2T4MKB3
LinkDB All DBs
Position
414414..416390
Genome map
AA seq 658 aa AA seqDB search
MIGRIIDERYELKHILGGGGMSNVYVAWDRILKRQVAVKMIHVPPNEKHETIARFEREVQ
NTTLLSHENIVSVLDVGEEDDCFFLVMEYIEGPTLSDYIKSHGQLAPEKAIKFAEQIFKG
IHHAHEKGIVHRDIKPQNIIIDRNQTLKIVDFGIAKALSETAMTQTNHVVGTVQYLSPEQ
AKGEKTGARSDIYSLGIVLYEMLIGHPPFNGETPVSIAIKQIQDPVPNVSDTRHDVPQAL
SNVILKATEKDQSKRYGSVAEMRHDLSSTLSEARAHETLYQPNESATKTITLDKNAIKNE
PSQPKSVKETTQIPVVTTTPHSKAPVNEGYQKRSRGKKILFGLIFTILFFSLFIFVAAAM
MGDKYSQVPDLRGKTEAEAEKMLKDNNLKVGRISQDYSEHYAKNHVMKIQPDVGEKVEQG
TKIDLVISKGEHIEDMPNLIGQSKADAQKTLEKLGFKNVHFTTAYTQHDIPKGNIEGQSI
TPGQKVSVSKERVEITESLGKRKVYVDDYTNKKFSSVKKELENKGLTVHVESERHDDTVK
EGDIINHSPRKTEVDEGSTVNFIVSKGDKSKDDESSPDKTYSESFTIPYTGKNDKPQKVE
IFKKDKNSNGASPIQSFTITKATTQSLSFVIEEGGEASYIVKVDGKTVKDETIAYDDI
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgattggacgcattatagatgaacgttatgaattaaaacatatcttaggtggaggcggc
atgagcaatgtttatgtcgcttgggaccgtattttaaaacgacaagttgctgtaaaaatg
atacacgttccgccaaatgaaaaacatgagaccattgcacgttttgaacgtgaagttcaa
aatacgacattattgtcacatgaaaatatagtgagtgtgcttgatgttggtgaagaagat
gattgcttctttttagtgatggagtatatcgaaggtccaacactttcagattatattaaa
tctcatggtcaattagcgcctgaaaaagccattaaatttgctgaacaaatttttaaaggc
attcatcatgcgcatgaaaaagggattgtacatcgagatattaaaccacaaaatatcatt
attgatcgtaatcaaacacttaagattgttgattttggaattgcaaaagcattaagtgaa
acagcgatgacccaaaccaatcatgtcgtgggtacggttcaatatttatctccagagcaa
gctaaaggtgaaaaaacgggtgcacgctcggatatttattctttaggtattgttttgtat
gaaatgcttatcggacatcctcccttcaatggtgaaacacctgtgagcattgctattaag
caaattcaagacccagtgcctaatgtatcggatacacggcatgatgtgccacaagcttta
agtaatgtgatattaaaagcaactgaaaaagaccaatctaaaaggtatgggtctgttgct
gaaatgcgccatgatttaagttcgacgttatctgaagcaagagcacatgaaacgttgtat
caacctaatgaaagtgcaacgaagaccattacactcgataaaaacgcaattaaaaacgaa
ccatctcaaccaaaatcagttaaagagacaacccaaatacctgtagtaacgacgacaccc
cactctaaagcaccagtgaatgaaggatatcaaaaacgttcaagagggaagaaaatcctt
tttggattgatattcactattttattcttcagcttatttatttttgtagctgctgcaatg
atgggtgacaaatatagtcaggtgcctgacctacgtggcaaaacagaggctgaagctgag
aaaatgcttaaagataataaccttaaggtaggacgtatttcacaagattatagcgagcac
tacgccaaaaaccatgttatgaaaatacaacctgacgtcggtgagaaagttgaacaaggc
acaaaaattgaccttgtcatttctaaaggtgaacatattgaagacatgccaaatctcatt
ggacaatccaaagcagatgcacaaaagaccttagaaaaattgggctttaaaaatgtgcat
tttacaactgcgtacacgcaacatgacatacctaaaggtaatattgaaggacaaagtatt
acgcctggtcaaaaagtttcagtttctaaagaacgtgttgaaattacagagtctctcggt
aaacgaaaagtttatgttgacgactacacaaataaaaaattctcttcggtgaaaaaagaa
ctagaaaataaaggtctgacagtacatgttgaatcagaacgtcatgatgatacggttaaa
gaaggggatatcattaatcattcgccacgtaaaactgaggtggatgaaggtagtaccgtt
aactttatcgtatcgaaaggtgataaatctaaagatgatgaatcatcacctgataaaaca
tattctgagtcatttacgattccatatacgggtaaaaatgataaacctcaaaaagttgag
atttttaaaaaagacaaaaatagtaatggcgcctcaccaatccaatcattcacaatcaca
aaagctacgactcaaagtttgagctttgttatcgaagagggtggcgaagcgagttatatt
gtaaaagttgatggtaaaacggtgaaagatgaaacaatcgcctatgatgatatttga

DBGET integrated database retrieval system