KEGG   Staphylococcus agnetis: EP23_06400Help
Entry
EP23_06400        CDS       T04155                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sagq  Staphylococcus agnetis
Pathway
sagq00010  Glycolysis / Gluconeogenesis
sagq00053  Ascorbate and aldarate metabolism
sagq00071  Fatty acid degradation
sagq00280  Valine, leucine and isoleucine degradation
sagq00310  Lysine degradation
sagq00330  Arginine and proline metabolism
sagq00340  Histidine metabolism
sagq00380  Tryptophan metabolism
sagq00410  beta-Alanine metabolism
sagq00561  Glycerolipid metabolism
sagq00620  Pyruvate metabolism
sagq00625  Chloroalkane and chloroalkene degradation
sagq01100  Metabolic pathways
sagq01110  Biosynthesis of secondary metabolites
sagq01120  Microbial metabolism in diverse environments
sagq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sagq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EP23_06400
   00053 Ascorbate and aldarate metabolism
    EP23_06400
   00620 Pyruvate metabolism
    EP23_06400
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EP23_06400
   00561 Glycerolipid metabolism
    EP23_06400
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EP23_06400
   00310 Lysine degradation
    EP23_06400
   00330 Arginine and proline metabolism
    EP23_06400
   00340 Histidine metabolism
    EP23_06400
   00380 Tryptophan metabolism
    EP23_06400
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EP23_06400
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EP23_06400
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EP23_06400
Enzymes [BR:sagq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     EP23_06400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALN77004
LinkDB All DBs
Position
complement(1261205..1262632)
Genome map
AA seq 475 aa AA seqDB search
MRNQTKQYINGEWVDSHSGETIDVINPATEEVFGRIAKGDETDVKQAVQAAHDVYIEFRH
TPVKERQALLGRIVDEYKKRKDDLIEAMTLELGAPVTKSEKVHYQMGLNHFQAAYDALDD
FQFEEQRGDHLVVKEAIGVAGLITPWNFPTNQTSLKLAAAFAAGAPVVLKPSEETPFAAI
ILAEIFEAAGVPKGVFNLVNGDGEGVGNPLSEHPDVRMMSFTGSGGTGSKIMEKASKDFK
KVSLELGGKSPYIILDDADVDGAAQAAVNKVVNNTGQVCTAGTRTLIPESMKADFLEKAK
MHMANVKVGDPQNKDTDMGPIINKKQYDQVQDYIQKGIDEGAQLYFGGTGHPDGLNQGYF
AKPTIFSDVDNKMTIAQEEIFGPVMSVITYTDIDDAIRIANDTKYGLAGYVYGQDKDTLK
KVARAIEAGTVEINEAGRTPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaccaaacgaaacaatatataaacggtgaatgggtagacagtcacagtggtgag
acgattgatgtgataaatcctgcaactgaagaagtttttggccgtattgccaaaggggat
gaaacagatgtcaaacaagcggtacaagctgcgcatgatgtatatatagagtttagacac
acaccagtaaaagaacgtcaagcattattagggcgtattgtagatgaatataaaaaacgt
aaagacgatttaattgaagcaatgacacttgaattaggtgcaccggtgacaaaatctgaa
aaggtacattaccaaatgggattgaatcattttcaagctgcatatgatgctttagatgat
tttcaatttgaagaacaacgtggcgatcatttagtggttaaagaagcgattggtgttgct
ggtttaattacaccatggaatttcccgacaaaccaaacgtcattaaaattagcagccgcc
tttgctgctggtgcaccagttgttttaaaaccttctgaagaaacaccttttgctgctatt
attttagctgaaattttcgaagctgcaggtgtacctaaaggtgtcttcaatctcgtcaat
ggagatggtgaaggtgtaggtaatccgttgagcgaacaccctgatgtgcgcatgatgtcc
tttacaggttctggcggcacaggctcaaaaattatggaaaaggctagtaaagacttcaaa
aaagtgtcattagaattaggtggtaaatcaccatatatcattttagatgatgctgatgtt
gatggtgctgcacaggccgctgttaataaagtggttaataatacaggacaagtgtgtacg
gctggtacacgaacgcttatccctgaatccatgaaagcagatttcttagaaaaagctaaa
atgcacatggcgaatgttaaggttggagatccccaaaataaagacacggatatgggacca
attattaacaaaaaacaatatgatcaagttcaagattatatccaaaaaggtatagatgaa
ggggcacaactttacttcggcggcacaggtcatcctgatggcttaaaccaaggttatttt
gcgaaacccacaattttctctgacgtagataataaaatgaccattgctcaggaagaaatt
tttggaccagttatgtcggtcatcacgtacacagatattgatgatgctattcgcattgcc
aatgatacaaagtatggcttagcaggttatgtatacggtcaagataaagatacattgaaa
aaagtagcgcgcgcgattgaagcgggtacagttgagattaatgaagctggtcgcacacca
gacttaccatttggaggttacaaacaatctggtattggacgtgaatggggcgactatggt
attgaagaatttttagaagtaaaatccattgcaggttattttaaataa

DBGET integrated database retrieval system