KEGG   Streptococcus agalactiae ILRI112: SAIL_19010Help
Entry
SAIL_19010        CDS       T02705                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sagr  Streptococcus agalactiae ILRI112
Brite
KEGG Orthology (KO) [BR:sagr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAIL_19010
Enzymes [BR:sagr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SAIL_19010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 NAD_binding_7 Lycopene_cycl Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CCW42913
LinkDB All DBs
Position
1775893..1777425
Genome map
AA seq 510 aa AA seqDB search
MVLDKEIKAQLAQYLDLLESDIVLQADLGDNDNSQKVKDFLDEIVAMSDRISLESTHLKR
QPSFGIAKKGHESRVIFSGLPMGHEFTSFILALLQVSGRAPKVDEDIIKRIKGIEKTINL
ETYVSLTCHNCPDVVQAFNIMAVLNPNITHTMIEGGMYQDEVKSKGIMSVPTVYKDQEEF
TSGRATIEQLLEQLDGPLDAEAFADKGVYDVLVIGGGPAGNSAAIYAARKGLKTGILAET
FGGQVIETVGIENMIGTLYTEGPKLMAQIEEHTKSYDIDIIKSQLATGIEKKELIEVTLA
NGAILQAKTAILALGAKWRNINVPGEEEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGM
EAALDLAGVTKHVTVLEFLPELKADQVLQERAAKTDNLTILKNVATKDIVGEDHVTGLNY
TDRDTNEEKHIDLEGVFVQIGLVPSTSWLKDSGIELNERQEIVVDKFGSTNIPGIFAAGD
CTDAAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtcttagataaagaaatcaaggctcaattagcgcaatatttagatttgctagaatct
gatattgtattacaagctgatttaggagataacgataattctcaaaaagtaaaggatttt
ctagatgaaattgtcgctatgtctgatcgcatcagccttgaatcaacacatttaaaacgt
caacctagttttgggattgcaaaaaaagggcatgaaagtcgcgttattttttcaggcttg
ccaatggggcatgaattcacatctttcattttagctttgttgcaagtctctggtcgcgca
ccaaaagttgatgaagatattatcaaacgaattaaggggattgagaaaactatcaatcta
gaaacttatgtttcattaacttgccataattgtccagatgtcgttcaagcctttaatata
atggctgttttgaatccgaatatcactcatactatgattgaaggaggcatgtatcaagac
gaagtcaaatcaaaaggcatcatgtctgttcctactgtttataaggaccaagaagaattt
acttctggccgtgctacaattgaacagcttttagaacaactagatggacctcttgatgct
gaagcatttgctgacaaaggtgtctatgatgttctagttattggtggtggtcctgcaggt
aacagtgctgcaatttatgccgctcgtaaagggttaaaaacaggtattttagcagaaact
tttggtggacaagttatcgaaacagttggtattgagaacatgattggtacactgtacaca
gaaggccctaaattaatggctcaaattgaagagcataccaaatcttacgatattgatatt
atcaagagtcaattagcaactggcattgagaaaaaagaattaattgaggtaacactggct
aacggagctattttacaagctaaaactgctatcctagctctgggtgctaagtggcgaaat
atcaacgttcctggcgaggaagaattccgcaataaaggtgttacttactgtccacattgt
gacggccctcttttcgaaggaaaagatgttgctgttataggtggtggtaattcaggtatg
gaagctgctttagatctagccggtgtcactaaacatgttacagtcctagaattcttacct
gagctcaaagcagaccaagtactgcaagaaagagcagctaaaactgacaatttaactatt
cttaagaatgttgctactaaagatatcgttggtgaagatcatgtcactggtttaaactat
accgatcgtgatacaaacgaagaaaaacacattgatttagaaggtgtttttgtacaaatt
ggtcttgtaccaagtacatcttggctcaaggatagcggcattgaactcaatgaacgtcaa
gaaattgtcgttgataaatttggctcaacaaatatccctggtatttttgctgcaggtgac
tgtacagatgctgcctacaagcaaatcattatttccatggggtctggtgccacagctgcc
attggcgcatttgattatttaatcagacaataa

DBGET integrated database retrieval system