KEGG   Streptococcus agalactiae SA20: SaSA20_0755Help
Entry
SaSA20_0755       CDS       T02338                                 

Definition
(GenBank) Branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sags  Streptococcus agalactiae SA20
Pathway
sags00010  Glycolysis / Gluconeogenesis
sags00020  Citrate cycle (TCA cycle)
sags00620  Pyruvate metabolism
sags01100  Metabolic pathways
sags01110  Biosynthesis of secondary metabolites
sags01120  Microbial metabolism in diverse environments
sags01130  Biosynthesis of antibiotics
sags01200  Carbon metabolism
Module
sags_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sags00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaSA20_0755
   00020 Citrate cycle (TCA cycle)
    SaSA20_0755
   00620 Pyruvate metabolism
    SaSA20_0755
Enzymes [BR:sags01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SaSA20_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 PYNP_C PLA2_B
Motif
Other DBs
NCBI-ProteinID: AFV72219
LinkDB All DBs
Position
796744..798132
Genome map
AA seq 462 aa AA seqDB search
MAVEIIMPKLGVDMQEGEILEWKKQVGDVVNEGDVLLEIMSDKTNMEIEAEDSGVLLKIT
HGNGDVVPVTETIGYIGAEGEEVTEASSSENTSVEENATQVTSEPEKVEETSEPSVPAAT
NGEKVRATPAARKLAREMSIDLALVSGTGANGRVHREDVESFKGAQPRITPLGRRIAEDQ
GVDIAEITGSGIRGKIVKNDVLAAMSPQAAEAPVETKATPTTEEKQLPEGVEVIKMSAMR
KAISKGMTNSYLTAPSFTLNYDIDMTEMMALRKKLIDPIMAKTGLKVSFTDLIGMAVVKT
LMKPEHRYLNASLINDAQEIELHNFVNIGIAVGLDDGLIVPVVHNADQMSLSDFVIASKD
VIKKTQEGKLKSAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPTPTVVDGE
IVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMEKPFGLLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgcctaaactcggggttgatatgcaagaaggcgaaatcctt
gagtggaaaaaacaggtaggtgatgttgttaatgaaggtgacgtcctacttgaaattatg
tcagataaaacaaatatggagattgaagcagaagactcaggtgttttactaaaaatcaca
catgggaatggagatgttgttcctgtaactgagacaattggctatattggtgctgaaggt
gaagaagtaacagaagcatcttcttctgaaaatacatcagttgaagaaaacgcgacacaa
gtaacttcagaaccagaaaaagttgaagaaacatcagaaccaagtgtgccagcagctaca
aatggtgaaaaagtacgtgccactcctgcagctcgtaaattagcaagagagatgtctatt
gaccttgcactagtatctggaacaggggcaaatggtcgcgttcacagagaagatgttgaa
agcttcaagggtgctcaaccacgtattacaccattggggcgtcgaattgctgaagatcaa
ggagttgatatagcagaaatcactggcagtggtattcgtggtaaaattgttaaaaatgat
gttttagctgctatgtcaccgcaagcagcagaggctcctgtagaaactaaagctacacca
acaacagaagaaaaacaattaccagaaggtgttgaagtcattaagatgtctgcaatgcgt
aaggctatttctaaaggtatgactaattcttacctcactgctccaagctttacacttaac
tatgacattgatatgactgaaatgatggctcttcgcaagaaattaattgatccaatcatg
gctaaaacaggcttgaaagtcagctttactgatttgattggaatggccgttgttaagaca
ttgatgaaaccagagcatcgatacctaaatgcttcattaattaacgatgcacaagaaatt
gagcttcataattttgttaatattggaatcgcagttggtcttgatgatggtttgattgtt
cctgttgttcacaatgctgatcaaatgtcactttctgactttgttatagcatctaaagat
gttattaagaaaactcaagaaggtaaattaaaatcagctgaaatgtcaggttcaacattc
tcaattactaacttaggtatgtttggtactaagacgtttaacccaattatcaatcaaccg
aactcagcaatccttggagtaggcgctactattccgactccaacagtggttgatggtgaa
attgtagctcgaccaatcatggcaatgtgtttaacaattgaccaccgtattgttgatgga
atgaatggtgctaagtttatggttgatcttaagaacttaatggaaaaaccatttggttta
cttatttga

DBGET integrated database retrieval system