KEGG   Streptococcus agalactiae COH1: GBSCOH1_0693Help
Entry
GBSCOH1_0693      CDS       T03434                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sagt  Streptococcus agalactiae COH1
Pathway
sagt00473  D-Alanine metabolism
sagt00550  Peptidoglycan biosynthesis
sagt01100  Metabolic pathways
sagt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sagt00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GBSCOH1_0693
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GBSCOH1_0693
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GBSCOH1_0693
Enzymes [BR:sagt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GBSCOH1_0693
Peptidoglycan biosynthesis and degradation proteins [BR:sagt01011]
 Precursor biosynthesis
  Amino acid ligase
   GBSCOH1_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK REC114-like
Motif
Other DBs
NCBI-ProteinID: CDN66159
LinkDB All DBs
Position
725584..726630
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFITQVGQFIKTQEFDEMPS
SDEKLMTNQTVDLDKMVRPSDIYDDNAIVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKQVLATVGVPQVAYQTYFEGDDLEHAIKLSLETLSFPIFVKPANMGSSV
GISKATDESSLRSAIDLALKYDSRILIEQGVTAREIEVGILGNNDVKTTFPGEVVKDVDF
YDYDAKYIDNKITMDIPAKVDEATMEAMRQYASKAFKAIGACGLSRCDFFLTKDGQIFLN
ELNTMPGFTQWSMYPLLWENMGLTYSDLIEKLVMLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaacattgatcttgctttacggtggtcgctctgcggaacgtgaagtatct
gtactgtctgcagaaagcgtcatgcgtgctattaattatgataaattttttgttaaaact
tattttatcacgcaagtaggtcaatttattaaaacacaagaatttgatgaaatgccatct
tcagatgaaaagttaatgacaaaccaaactgttgatttagacaaaatggttcgtccaagt
gatatctatgatgataatgcaattgttttccccgttttacatggaccaatgggggaagat
ggttctatccaaggatttttagaagttttaaggatgccttatgttgggactaatattcta
tcttcaagcgtggctatggataaaattacaacaaaacaagtccttgcaacagtaggtgta
cctcaggttgcatatcaaacttattttgagggtgatgatttggaacatgcgattaaactc
tctttagaaactttaagtttcccaatttttgtaaaaccggctaatatggggtcatcagta
ggtatttcaaaagcgacagatgaatcctcacttcgctctgcaattgacttagctctcaag
tatgatagccgtattttgattgaacaaggcgtgacagctcgtgaaattgaagtaggtatt
ttaggcaataatgatgttaagacaacttttcctggcgaagttgttaaagacgtcgatttc
tatgactatgacgccaaatatattgataataaaattactatggatattccagctaaagtt
gatgaagcaactatggaagcaatgcgtcaatatgcaagtaaagcttttaaagcaatcggg
gcttgtggtttatcacgctgtgatttctttttgacgaaagatggacaaatcttcttaaac
gaactgaatacaatgcccggttttactcagtggtcaatgtatcctctgctttgggaaaat
atggggctaacttatagtgatttgattgaaaagttagttatgttagctaaagaaatgttt
gaaaaacgtgagagtcatttaatttaa

DBGET integrated database retrieval system