KEGG   Streptococcus agalactiae COH1: GBSCOH1_0807Help
Entry
GBSCOH1_0807      CDS       T03434                                 

Definition
(GenBank) acetoin dehydrogenase, thymine PPi dependent, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sagt  Streptococcus agalactiae COH1
Pathway
sagt00010  Glycolysis / Gluconeogenesis
sagt00020  Citrate cycle (TCA cycle)
sagt00620  Pyruvate metabolism
sagt01100  Metabolic pathways
sagt01110  Biosynthesis of secondary metabolites
sagt01120  Microbial metabolism in diverse environments
sagt01130  Biosynthesis of antibiotics
sagt01200  Carbon metabolism
Module
sagt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sagt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBSCOH1_0807
   00020 Citrate cycle (TCA cycle)
    GBSCOH1_0807
   00620 Pyruvate metabolism
    GBSCOH1_0807
Enzymes [BR:sagt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GBSCOH1_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 PYNP_C PLA2_B
Motif
Other DBs
NCBI-ProteinID: CDN66273
LinkDB All DBs
Position
849313..850701
Genome map
AA seq 462 aa AA seqDB search
MAVEIIMPKLGVDMQEGEILEWKKQVGDVVNEGDVLLEIMSDKTNMEIEAEDSGVLLKIT
HGNGDVVPVTETIGCIGAEGEEVTEASSSENTSVEENATQVTSEPEKVEETSEPSVPAAT
SGEKVRATPAARKLAREMSIDLALVSGTGANGRVHREDVESFKGAQPRITPLARRIAEDQ
GVDIAEITGSGIRGKIVKNDVLAAMSPQAAEAPVKTKATPTTEEKQLPEGVEVIKMSAMR
KAISKGMTNSYLTAPSFTLNYDIDMTEMMALRKKLIDPIMAKTGLKVSFTDLIGMAVVKT
LMKPEHRYLNASLINDAQEIELHNFVNIGIAVGLDDGLIVPVVHNADQMSLSDFVIASKD
VIKKTQEGKLKSAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPTPTVVDGE
IVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMENPFGLLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgcctaaactcggggttgacatgcaagaaggcgaaatcctt
gagtggaaaaaacaggtaggtgatgttgttaatgaaggtgacgtcctacttgaaattatg
tcagataaaacaaatatggagattgaagcagaagactcaggtgttttactaaaaatcaca
catgggaatggagatgttgttcctgtaactgagacaattggctgtatcggtgctgaaggt
gaagaagtaacagaagcatcttcttctgaaaatacatcagttgaagaaaacgcgacacaa
gtaacttcagaaccagaaaaagttgaagaaacatcagaaccaagtgtgccagcagctaca
agtggtgaaaaagtacgtgccactcctgcagctcgtaaattagcaagagagatgtctatt
gaccttgcactagtatctggaacaggggcaaatggtcgcgttcacagagaagatgttgaa
agcttcaagggtgctcaaccacgtattacaccattggcacgtcgaattgctgaagatcaa
ggagttgatatagcagaaatcactggcagtggtattcgtggtaaaattgttaaaaatgat
gttttggctgctatgtcaccgcaagcagcagaggctcctgtaaaaacgaaagctacacca
acaacagaagaaaaacaattaccagaaggtgttgaagtcattaagatgtctgcaatgcgt
aaggctatttctaaaggtatgactaactcttacctcactgctccaagctttacacttaac
tatgatattgatatgactgaaatgatggctcttcgcaagaaattaattgatccaatcatg
gctaaaacaggcttgaaagtcagctttactgatttgattggaatggccgttgttaagaca
ttgatgaaaccagagcatcgatacctaaatgcttcattaattaacgatgcacaagaaatt
gagcttcataattttgttaatattggaatcgcagttggtcttgatgatggtttgattgtt
cctgttgttcacaatgctgatcaaatgtcactttctgactttgttatagcatctaaagat
gttattaagaaaactcaagaaggtaaattaaaatcagctgaaatgtcaggttcaacattc
tcaattactaacttaggtatgtttggtactaagacgtttaacccaattatcaatcaaccg
aactcagcaatccttggagtaggtgctactattccgactccaacagtggttgatggtgaa
attgtagctcgaccaatcatggcaatgtgtttaacaattgaccaccgtattgttgatgga
atgaatggtgctaagtttatggttgatcttaagaacttaatggaaaacccatttggttta
cttatttga

DBGET integrated database retrieval system