KEGG   Streptococcus agalactiae COH1: GBSCOH1_1681Help
Entry
GBSCOH1_1681      CDS       T03434                                 

Definition
(GenBank) alkyl hydroperoxide reductase, subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sagt  Streptococcus agalactiae COH1
Brite
KEGG Orthology (KO) [BR:sagt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GBSCOH1_1681
Enzymes [BR:sagt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GBSCOH1_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 FAD_oxidored HI0933_like DAO AlaDh_PNT_C Thi4 FAD_binding_3 NAD_binding_7 NAD_binding_8 Lycopene_cycl Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CDN67147
LinkDB All DBs
Position
1748385..1749917
Genome map
AA seq 510 aa AA seqDB search
MVLDKEIKAQLAQYLDLLESDIVLQTDLGDNDNSQKVKDFLDEIVAMSDRISLESTHLKR
QPSFGIAKKGQESRVIFSGLPMGHEFTSFILALLQVSGRAPKVDEDIIKRIKGIEKTINL
ETYVSLTCHNCPDVVQAFNIMAVLNPNITHTMIEGGMYQDEVKSKGIMSVPTVYKDQEEF
TSGRATIEQLLEQLDGPLDAEAFADKGVYDVLVIGGGPAGNSAAIYAARKGLKTGILAET
FGGQVIETVGIENMIGTLYTEGPKLMAQIEEHTKSYDIDIIKSQLATGIEKKELVEVTLA
NGAILQAKTAILALGAKWRNINVPGEEEFRNKGVTYCPHCDGPLFEGKNVAVIGGGNSGM
EAALDLAGVTKHVTVLEFLPELKADQVLQERAAKTDNLTILKNVATKDIVGEDHVTGLNY
TDRDTNEEKHIDLEGVFVQIGLVPSTSWLKDSGIELNERQEIVVDKFGSTNIPGIFAAGD
CTDAAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtcttagataaagaaatcaaggctcaattagcgcaatatttagatttgctagaatct
gatattgtattacaaactgatttaggagataacgataattctcaaaaagtaaaggatttt
ctagatgaaattgtcgctatgtctgatcgtatcagccttgaatcaacacatttaaaacgt
caacctagttttgggattgcaaaaaaagggcaagaaagtcgcgttattttttcaggcttg
ccaatggggcatgaattcacatctttcattttagctttgttgcaagtctctggtcgcgca
ccaaaagttgatgaagatattatcaaacgaattaaggggattgagaaaactatcaatcta
gaaacttatgtttcattaacttgccataattgtccagatgtcgttcaagcctttaatata
atggctgttttgaatccaaatatcactcatactatgattgaaggaggcatgtatcaagac
gaagtcaaatcaaaaggtatcatgtctgttcctactgtttataaggaccaagaagaattt
acttctggccgtgctacaattgaacagcttttagaacaactagatggacctcttgatgct
gaagcatttgctgacaaaggtgtctatgatgttctagttattggtggtggtcctgcaggt
aacagtgctgcaatttatgccgctcgtaaagggttaaaaacaggtattttagcagaaact
tttggtggacaagttatcgaaacagttggtattgagaacatgattggtacactgtacacc
gaaggccctaaattaatggctcaaattgaagagcataccaaatcttacgatattgatatt
atcaagagtcaattagcaactggcattgagaaaaaagaattagttgaggtaacactggct
aacggagctattttacaagctaaaactgctatcctagctctgggtgctaagtggcgaaat
atcaacgttcctggcgaggaagaattccgcaataaaggtgttacttactgtccacattgt
gatggccctcttttcgaaggaaaaaatgttgctgttataggtggtggtaattcaggtatg
gaagctgctttagatctagccggtgtcactaaacatgttacagtcctagaattcttacct
gagctcaaagcagaccaagtactgcaagaacgagcagctaaaactgacaatttaactatt
cttaagaatgttgctactaaagatatcgttggtgaagatcatgtcactggtttaaactat
accgatcgtgatacaaacgaagaaaaacacattgatttagaaggtgtttttgtacaaatt
ggtcttgtaccaagtacttcttggctcaaggatagcggcattgaactcaatgaacgtcaa
gaaattgtcgttgataaatttggctcaacaaatatccctggtatttttgctgcaggtgac
tgtacagatgctgcctacaagcaaatcattatttccatggggtctggtgccacagctgcc
attggcgcatttgattatttaatcagacaataa

DBGET integrated database retrieval system