KEGG   Sagittula sp. P11: CDO87_01060Help
Entry
CDO87_01060       CDS       T05219                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00010  Glycolysis / Gluconeogenesis
sagu00020  Citrate cycle (TCA cycle)
sagu00620  Pyruvate metabolism
sagu01100  Metabolic pathways
sagu01110  Biosynthesis of secondary metabolites
sagu01120  Microbial metabolism in diverse environments
sagu01130  Biosynthesis of antibiotics
sagu01200  Carbon metabolism
Module
sagu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDO87_01060
   00020 Citrate cycle (TCA cycle)
    CDO87_01060
   00620 Pyruvate metabolism
    CDO87_01060
Enzymes [BR:sagu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CDO87_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 QRPTase_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AUC51867
UniProt: A0A2K8W6D1
LinkDB All DBs
Position
214124..215425
Genome map
AA seq 433 aa AA seqDB search
MPVEIQMPALSPTMEEGTLAKWLVKEGDTVSSGDVLAEIETDKATMEFEAVDEGVIGRIV
VAEGTAEVKVGTVIAVLLEEGETADDLGATGGPKAPPPSEPKETQAAPEAEIKAAPPAPE
RSDGERIFASPLARRIAQQKGLDLSQIKGSGPRGRIVKADVEGATAAPAAAKPAAAAATP
AVAPAKAEAAQVDPSSVAALYADRTYTEVPLDGMRRTIAARLTEAKQTIPHFYLRRDITL
DALMAFRAQLNEQLAPRGVKLSVNDFIIKACALALQQVPKANAVWAGDRILQLTPSDVAV
AVAIEGGLFTPVLRDAHQKTLSALSAEMKDLATRARDRKLAPSEYQGGSFAISNLGMFGI
ENFDAVINPPHGAILAVGAGVKKPVVNADGALAVATVMSVTLSVDHRVIDGALGAELLAA
IKDNLENPLAMLA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtggaaattcagatgcccgcactgtcgcccacgatggaagagggcacactggcc
aagtggctggttaaggagggcgacacggtatcttccggtgacgtgctggcagagatcgag
accgacaaggcaacgatggagttcgaggccgtcgacgagggcgtgatcggccggatcgtc
gtcgccgagggtacggcagaggtgaaggtcggcacggtgatcgcggtccttctggaagag
ggcgagacggctgacgacctaggcgcaacgggcggccccaaggcccctcccccgtccgaa
ccgaaggagacgcaggcagcccccgaggccgagatcaaagccgcgccgcccgcgccggaa
cgctctgacggggaacggatcttcgcctcccccctcgcccggcggatcgcccagcagaag
ggcctcgacctgtcgcagatcaagggctccggcccgcgcggccgcatcgtgaaggccgat
gtcgaaggggcgacggctgcccccgccgcggcgaaaccggcggccgctgccgccacaccc
gctgtggcgcctgccaaagccgaagcggcgcaggtcgatccgtcctccgtcgcggcgctt
tatgcggaccggacctatacggaagtgccgctggacggcatgcgccggaccattgcagcc
cgcctgaccgaggccaagcagaccatcccccatttctacctgcgccgggacatcacgctg
gacgcgctgatggccttccgagcgcagctgaacgaacagctcgcaccgcgcggcgtgaag
ctgtcggtcaacgacttcatcatcaaggcctgcgccctggcgcttcagcaggtgccgaag
gccaatgccgtctgggccggtgaccgcatcctgcaactgacgccctcggacgtggcggta
gccgtggcaatcgagggcggcctctttacgcccgtcctgcgcgatgcgcatcagaaaaca
ctctcggccctctcggccgagatgaaggacctcgcgacccgcgcccgcgaccgcaaactc
gcaccctccgaataccagggcggcagtttcgcgatttccaacctcggcatgttcgggatc
gagaacttcgatgcggtcatcaacccgccacacggcgcgatccttgcggtcggcgccggg
gtgaagaagccggtcgtaaacgcggacggggcgctggccgtggcaaccgtgatgtcggtc
accctgtcggtggatcaccgtgtcatcgacggcgcactcggcgcggaactgctggccgcc
atcaaggacaacctcgagaacccgctggccatgctggcctga

DBGET integrated database retrieval system