KEGG   Sagittula sp. P11: CDO87_07125Help
Entry
CDO87_07125       CDS       T05219                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00061  Fatty acid biosynthesis
sagu01100  Metabolic pathways
sagu01212  Fatty acid metabolism
Module
sagu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CDO87_07125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sagu01004]
    CDO87_07125
Enzymes [BR:sagu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CDO87_07125
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CDO87_07125
Lipid biosynthesis proteins [BR:sagu01004]
 Fatty acid synthase
  Component type
   CDO87_07125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: AUC52984
UniProt: A0A2K8W9I7
LinkDB All DBs
Position
complement(1455797..1456306)
Genome map
AA seq 169 aa AA seqDB search
MADYPTSFGKEDLLKCARGELFGVGNAQLPEPPMLMMDRITDISGDGGLHGKGHVVAEFD
ITPDLWFFECHFPGNPIMPGCLGLDGLWQLTGFNLGWRGWTGRGYALGVGEVKLKGMVRP
DRKMLTYKVDFTKAVQTRRLTMGVADGIVEADGEIIYEVKDMKVALSES
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccgattaccccaccagcttcggcaaggaagacctgttgaaatgcgcccgcggcgag
ctgttcggcgtgggcaacgcccagctgcccgagccgccgatgctgatgatggaccggatc
accgacatctccggcgacggcggcctgcacggcaaggggcacgtcgtggcggaattcgac
atcaccccggacctgtggttctttgagtgccacttccccggcaacccgatcatgccgggc
tgcctcggccttgacggcctgtggcagctgaccggcttcaacctcggctggcgcggctgg
accgggcgcggctatgcgctgggtgtgggcgaggtcaagctgaagggcatggtccgtccg
gaccgcaagatgctgacctacaaggtggatttcaccaaggccgtgcagacccgccgcctg
acgatgggcgtggccgacggcatcgtcgaggccgacggcgagatcatctacgaggtcaag
gacatgaaggtggcgctcagcgagagctga

DBGET integrated database retrieval system