KEGG   Sagittula sp. P11: CDO87_07195Help
Entry
CDO87_07195       CDS       T05219                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00220  Arginine biosynthesis
sagu00250  Alanine, aspartate and glutamate metabolism
sagu00270  Cysteine and methionine metabolism
sagu00330  Arginine and proline metabolism
sagu00350  Tyrosine metabolism
sagu00360  Phenylalanine metabolism
sagu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sagu00401  Novobiocin biosynthesis
sagu01100  Metabolic pathways
sagu01110  Biosynthesis of secondary metabolites
sagu01130  Biosynthesis of antibiotics
sagu01210  2-Oxocarboxylic acid metabolism
sagu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDO87_07195
   00270 Cysteine and methionine metabolism
    CDO87_07195
   00220 Arginine biosynthesis
    CDO87_07195
   00330 Arginine and proline metabolism
    CDO87_07195
   00350 Tyrosine metabolism
    CDO87_07195
   00360 Phenylalanine metabolism
    CDO87_07195
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDO87_07195
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CDO87_07195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sagu01007]
    CDO87_07195
Enzymes [BR:sagu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     CDO87_07195
Amino acid related enzymes [BR:sagu01007]
 Aminotransferase (transaminase)
  Class I
   CDO87_07195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AUC52996
UniProt: A0A2K8W9P7
LinkDB All DBs
Position
complement(1468888..1470105)
Genome map
AA seq 405 aa AA seqDB search
MPFLSETLSRVKPSPTVAVTQLARDLKAQGRDIISLGAGEPDFDTPDNIKAAAIAAIEAG
KTKYTAPDGIPELKEAVCAKFRRENGLEYTPAQISVSTGGKQVLYNALMATLNPGDEVVI
PAPFWVSYPDIVRLGGGEPVIVEGERQLGFKITPEALEAAITPKTKWFIFNSPSNPTGAG
YTRDELKALTDVLMRHPHVWVMTDDMYEHLAYDGFEFVTPAQVEPGLYDRTLTCNGVSKA
YAMTGWRIGYAGGPEHLIAAMRKIQGQSTTNPCSISQWAAVEALNGPQDFLAERSAAFKR
RRDLVVEGLNACPGITCAVPEGAFYVYPSVADCIGKVSKAGTPIADDEAFCTALLEEEGV
AVVFGSAFGLSPYFRVSYAASDEMLTEACVRIRRFCEGLKDGEGN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcctgtccgagacgctttcgagggtaaaaccctctccgacggttgccgtgacg
caactggcccgtgacctgaaggcgcagggccgcgacatcatcagcctcggcgccggcgag
ccggactttgacacgccggacaacatcaaggctgccgcgattgcggcaatcgaggcgggg
aaaacgaaatacaccgcaccggacgggatccccgagctgaaggaggcggtctgcgccaag
ttccgccgcgaaaacgggctggagtacacgccggcgcagatcagcgtgtcgacgggcggc
aagcaggtgctttacaacgcgctgatggcgacgctgaacccgggcgacgaggtggtgatc
cccgcgcccttctgggtcagctatcccgacatcgtgcggctggggggcggcgagccggtg
atcgtggagggcgagcggcagcttggcttcaagatcacgccggaggcgctggaggccgcg
atcacgccgaagaccaagtggttcatcttcaactcgccgtcgaaccccacgggcgcgggc
tatacgcgggacgagctgaaggcgctgaccgacgtgctgatgcgccatccccatgtctgg
gtgatgaccgacgacatgtacgaacacctggcctacgacgggttcgagttcgtcaccccc
gcacaggtggagccgggtctctatgaccggacgctgacctgcaacggcgtgtcgaaggcc
tatgcgatgaccggctggcggatcggctatgccggcgggccggagcacctgatcgccgcc
atgcgcaagatccaggggcagtcgacgaccaacccctgttcgatcagccagtgggccgcg
gtggaggcgctgaacggcccgcaggacttcctggcggagcggtcggcggcgttcaagcgg
cggcgcgatcttgtggtcgaggggctgaacgcctgtccggggatcacctgcgcggtgcct
gaaggggcgttctacgtctacccttcggtcgcggactgcatcggcaaggtgtcgaaggcc
gggacgccgatcgccgacgacgaggcgttctgcaccgcgctccttgaagaggagggcgtg
gccgtcgtcttcgggtcggccttcggtctcagcccctatttccgcgtcagctatgccgct
tcggacgagatgctgacagaggcttgcgtgcgaattcgccggttctgcgaggggttgaaa
gacggggagggcaactga

DBGET integrated database retrieval system