KEGG   Sagittula sp. P11: CDO87_08380Help
Entry
CDO87_08380       CDS       T05219                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00240  Pyrimidine metabolism
sagu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CDO87_08380
Enzymes [BR:sagu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CDO87_08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_14 DUF2075
Motif
Other DBs
NCBI-ProteinID: AUC53211
UniProt: A0A2K8WA72
LinkDB All DBs
Position
complement(1706923..1707501)
Genome map
AA seq 192 aa AA seqDB search
MAKLHFHYSTMNAGKSTLLLQAAHNYNERGMETYLMIAAFDDRAGKGRIGSRIGLAREAD
VFGTHSDLFEMIEARRAKGDVACIFVDEAQFMTTEQVWQLARVVDDLDVPVMAYGLRVDF
RGELFPGSAALLALADVMREVRTICHCGRKATMVIRQDAEGRALLDGAQVQIGGNEAYVS
LCRRHWRQKVGR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgcacttccattactcgaccatgaacgcgggcaagtcgacgctgcttctg
caggcggcgcacaactacaatgaacgcgggatggagacttacctgatgatcgccgccttc
gacgaccgcgccggcaaggggcggatcggatcgcggatcggcctcgcgcgggaggcggat
gtcttcggcacccactccgatcttttcgagatgatcgaggcgcggcgggcgaagggcgat
gtggcctgcatcttcgtcgacgaggcgcagttcatgacgaccgaacaggtctggcagctg
gcccgcgtggtcgacgatctcgacgtgcccgtgatggcctatggcctgcgggtggatttc
cgaggcgagctgttccccggttccgcggcgctgctggcgctggcggacgtgatgcgggag
gtccggaccatctgccactgcggccgcaaggcgacgatggtgatccggcaggacgccgag
ggccgggcattgctggacggcgcgcaggtccagatcggcggcaacgaagcttacgtcagc
ctgtgccgccgccactggcggcaaaaagtaggacgctag

DBGET integrated database retrieval system