KEGG   Sagittula sp. P11: CDO87_21510Help
Entry
CDO87_21510       CDS       T05219                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00061  Fatty acid biosynthesis
sagu00780  Biotin metabolism
sagu01100  Metabolic pathways
sagu01130  Biosynthesis of antibiotics
sagu01212  Fatty acid metabolism
Module
sagu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CDO87_21510
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CDO87_21510
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CDO87_21510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sagu01004]
    CDO87_21510
Enzymes [BR:sagu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CDO87_21510
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CDO87_21510
Lipid biosynthesis proteins [BR:sagu01004]
 Fatty acid synthase
  Component type
   CDO87_21510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AUC55575
UniProt: A0A2K8WGZ5
LinkDB All DBs
Position
4509973..4510779
Genome map
AA seq 268 aa AA seqDB search
MSNGLMAGKRGLIMGLANDKSIAWGIAKALSEAGAELAFSYQGEALKKRVDPLASQLGSQ
IVLPCDVGDEGSIDLLFNALEEEWGGLDFVVHAIGFSDKNELRGRYVDTTRGNFTMTMDI
SVYSFTAVMQRAEKLMKSGGAALTLTYYGAERIMPHYNVMGVAKAALEASVRYLAEDLGK
DGIRVNAISAGPIKTLAASGIGDFRYIMKWNEYNSPLRRNVTIDDVGGSALYLLSDLSNG
VTGETHHVDSGYHVVGMKAVDAPDIQKG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgggttgatggcgggcaaacgcggcctcatcatggggctggcgaacgacaag
tctatcgcctggggcattgccaaggcgctgagcgaagcgggcgcggagctggcattctcc
taccagggcgaggcgctgaagaagcgtgtcgatcctcttgcctcccaactgggcagccag
atcgtcctgccctgcgacgtgggcgacgaaggctctatcgacttgttgttcaatgccttg
gaagaagaatggggcggactcgacttcgtcgtccatgccatcggcttctcggacaagaac
gaactgcgcgggcgctacgtcgacaccacgcgcggcaatttcaccatgacgatggacatt
tccgtctacagtttcaccgccgtgatgcagcgcgccgagaagctgatgaagagcggcggg
gccgccttgacgctcacctactacggcgccgaacgcatcatgccacactataatgtgatg
ggcgtggccaaggcggcgctggaagcttcggtccgttaccttgccgaggatctgggcaag
gacggcatccgggtcaacgcgatctcggccggtccgatcaagacgctggccgcttcgggc
atcggcgatttccgctacatcatgaagtggaacgagtacaattcgcccctccgccggaac
gtgaccatcgacgatgtgggcgggtccgcgctttacctgctgtccgacctgtcgaacggc
gtcaccggcgagacgcaccatgtcgacagcggctatcacgtcgtcggcatgaaggcggtg
gacgcgccggacatccagaagggctga

DBGET integrated database retrieval system