KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1503Help
Entry
SaurJH1_1503      CDS       T00556                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00020  Citrate cycle (TCA cycle)
sah00310  Lysine degradation
sah00380  Tryptophan metabolism
sah01100  Metabolic pathways
sah01110  Biosynthesis of secondary metabolites
sah01120  Microbial metabolism in diverse environments
sah01130  Biosynthesis of antibiotics
sah01200  Carbon metabolism
Module
sah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SaurJH1_1503
  Amino acid metabolism
   00310 Lysine degradation
    SaurJH1_1503
   00380 Tryptophan metabolism
    SaurJH1_1503
Enzymes [BR:sah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SaurJH1_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N T3SS_HrpK1 DUF1542 DUF1840
Motif
Other DBs
NCBI-ProteinID: ABR52352
UniProt: A6U1N4
LinkDB All DBs
Position
complement(1543629..1546427)
Genome map
AA seq 932 aa AA seqDB search
MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSTIKNDDSIVPALKST
SSQNSDGTIKRVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGISA
GIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYKVTLNNN
EKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGM
AHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIKTTD
SYGTMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAGAPTTDHHKAMPIIIHGDAAYP
GQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKGYDVPIFHV
NADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPYQNIRKHDS
VEYVFGKKLVNEGVISEDEMHSFIEQVQKELRQAHDKINKADKMDNPDMEKPAELALPLQ
ADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGLVDWAQAEQLAFA
TILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEA
AVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSKWGERSGLTLFLPHAY
EGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAASLDSEQMRPLVVMSPK
SLLRNKTVAKPIDEFTSGGFEPILTESYQADKVTKVILATGKMFIDLKEALAKNPDESVL
LVAIERLYPFPEEEIEALLAQLPNLEEVSWVQEEPKNQGAWLYVYPYVKVLVADKYDLSY
HGRIQRAAPAEGDGEIHKLVQNKIIENALKNN
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgaaagaaaagaagtttcagaggctcctgtaaacttcggtgcgaatttaggt
ctaatgttagatctatatgatgactttttacaagatccatcatctgtaccagaagattta
caagtcttattcagcacaattaagaatgatgactcaattgtaccagctttaaaaagtaca
agtagtcaaaatagcgacggcacaattaagcgtgtcatgcgtctaattgataatattcgc
caatacgggcatcttaaagccgatatttatcctgtaaatcctccaaaaaggaaacatgta
cctaaattagagattgaagactttgatttagatcaacagactttggaaggtatatcagca
ggaattgtttcagatcactttgccgacatttatgataatgcttatgaagcaattttaaga
atggaaaaacgttacaaaggaccaattgcatttgagtatacacatattaataacaatacc
gaacgtggttggttaaaaagaagaattgaaacgccatataaagtaacgttaaataataac
gaaaaaagggcactattcaaacaattagcgtatgttgaagggtttgaaaaatatcttcat
aaaaacttcgttggtgcaaagcgtttttcaattgaaggggtagacgcacttgtaccgatg
ttacaacgtactattacgattgctgcgaaagaaggtattaaaaatatacaaataggcatg
gctcaccgtggacgtttaaacgttttaacgcatgtcttagaaaaaccgtacgaaatgatg
atttcagaatttatgcatacagatccaatgaaattcttacctgaagatggtagcttgcag
ttaactgctggatggactggtgatgtgaaatatcaccttggtggcattaaaactactgat
tcatacggtacaatgcagcgtattgcactggctaacaatccaagtcacttggaaattgtt
gcacctgttgttgaggggcgtacgagagcagcacaagatgatacacaacgagctggggct
ccgacgactgatcatcataaagcaatgccaattattatacatggcgatgctgcttatcct
ggtcaaggaattaacttcgaaacaatgaacttaggaaacttgaaaggctattctacgggt
ggttcattgcatattattactaacaatagaattggatttactacagaaccaattgatgca
cgttcaacaacttattctacagatgtggccaaaggttatgatgtgccaatattccatgtc
aatgctgatgacgttgaagctactattgaagcaattgatattgcaatggaatttagaaaa
gagtttcataaagacgtcgttattgatttagtaggttatcgtcgtttcggacataacgaa
atggatgaaccatcaattactaatccagttccttatcagaatattcgcaaacatgactct
gttgaatatgtgtttggtaaaaagcttgttaatgaaggtgtcatttcagaagatgaaatg
cattcatttatagaacaagtccaaaaggaactaagacaagctcatgataaaattaataaa
gctgataaaatggataatccagatatggaaaaacctgcagaacttgcattaccgttacaa
gcagacgaacaatcatttacgtttgatcatttgaaagaaataaatgatgcattgttaaca
tatccggatggctttaacattttgaaaaagttaaacaaagttcttgagaagcgtcatgag
ccgtttaataaagaagatggcttagttgattgggcacaagcagaacaacttgcatttgcg
acaattttacaagatggtacaccgattcgcttaactggtcaagatagtgaacgtggtaca
ttcagtcataggcatgccgtgttacatgatgagcaaacaggtgaaacatatacaccttta
catcatgttcctgatcaaaaagcgacatttgatatacacaattctccgctttcagaagca
gcagtagttggttttgaatacggctataatgtggaaaacaaaaaaagcttcaatatttgg
gaagcgcaatatggtgattttgcaaatatgtcacaaatgatttttgacaacttcttattc
agttctcgctcaaaatggggagaacgttcaggattaacattattcttacctcatgcatat
gagggtcaaggacctgaacattcatcagcaagattagagcgatttttacaattagctgct
gaaaataattgcacagttgtcaacttatctagttcaagtaattatttccacttattgcgt
gcacaagcagctagtttagattctgaacaaatgcgaccattggttgttatgtcaccaaaa
agcttattgagaaataaaacagttgccaaaccaattgatgagtttacttctggtggattt
gagccaattttgacagaatcatatcaagcggataaggttacaaaagttattttagcaact
ggtaaaatgttcattgatttaaaagaagcattagctaaaaatccagacgaatccgtgtta
ctcgttgcgattgaaagattgtatccattcccagaggaagagattgaagcattactagca
caattgccaaaccttgaagaagtgtcatgggtacaagaagaacctaaaaatcaaggtgca
tggttatatgtctatccatatgttaaagtgctagttgcagataaatatgatttaagttat
catggcagaattcaaagggctgctccagctgaaggcgatggagaaattcataaacttgtt
caaaataaaattatagaaaatgcattaaaaaataactag

DBGET integrated database retrieval system