KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2173Help
Entry
SaurJH1_2173      CDS       T00556                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00061  Fatty acid biosynthesis
sah00780  Biotin metabolism
sah01100  Metabolic pathways
sah01212  Fatty acid metabolism
Module
sah_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SaurJH1_2173
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SaurJH1_2173
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sah01004]
    SaurJH1_2173
Enzymes [BR:sah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SaurJH1_2173
Lipid biosynthesis proteins [BR:sah01004]
 Fatty acid synthase
  Component type
   SaurJH1_2173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ABR53002
UniProt: A6U3I4
LinkDB All DBs
Position
complement(2258852..2259292)
Genome map
AA seq 146 aa AA seqDB search
METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPG
VLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIG
KGNAKATVDGQLACSCELTFAIQDVK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaatttttgattataaccaaattaaacaaattatacctcacagacagccattt
ttattaattgataaagtagttgaatatgaagaaggtcaacgttgtgtggctattaaacaa
gtatcaggaaacgaaccattctttcaagggcattttcctgagtatgcggtaatgccaggc
gtattaattactgaagcgttagctcaaacaggtgcggtagctattttaaatagtgaagaa
aataaaggtaaaatcgctttatttgctggtattgataaatgtcgttttaaacgtcaagta
gtacctggtgatactttaacgttggaagtagaaatcactaaaattaaaggaccaatcggt
aaaggtaatgctaaagctactgtcgatggtcaacttgcttgtagttgtgaacttacattt
gcaattcaagatgtaaaataa

DBGET integrated database retrieval system