KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0059Help
Entry
Saci_0059         CDS       T00251                                 

Definition
(GenBank) conserved Archaeal protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00620  Pyruvate metabolism
sai00680  Methane metabolism
sai00720  Carbon fixation pathways in prokaryotes
sai01100  Metabolic pathways
sai01120  Microbial metabolism in diverse environments
sai01200  Carbon metabolism
Module
sai_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saci_0059
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_0059
   00680 Methane metabolism
    Saci_0059
Enzymes [BR:sai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Saci_0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AAY79488
UniProt: Q4JCJ1
LinkDB All DBs
Position
44222..45793
Genome map
AA seq 523 aa AA seqDB search
MVFNLFFAYALQMRKIPRTMSTQHPDNAKVPEWNQGEAISGENEIIEAYLAFSRYGVEEV
MWDAEGKDVDTHVVRKLLSQYPEFFRHRILGKDIFLTYRVPNPKIEGAERKVFAETLNTI
PITYDLAEKFYGENPNPPVFEVILPFTTSYEELIAVIKFYEKVIVNSDNTKLVDDTYVKD
IIGETNPKKIEVIPLIEDRDSMLRIDTIVGKYIEIERPPYLRVFLARSDPAMNYGLLSAV
LSVKYALSRLSKMEKIYGVKIFPLLGVGSLPFRGHFSPYNVENTLNEYRGIYTFTVQSAF
KYDYEDDLVISAIKKVNGTNVTEKIELSEEDEEIISNVTRKYTQGYQNKIEALADVINKV
ALLLPRRRARKLHIGLFGYSRSTGKVTLPRAISFVGSLYTIGIPPEIIGLSSLSKMTDQE
LNAIFNNYKYLKNDLQFAARFVNFEALQLLKDIWNIDAEVVKAIKEDIDYAENSLGIRIG
ESDYMSKKHVLLSTLALLSIKEGKLDEAKTYIKEMAIVRRAIG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggtttttaacctctttttcgcttatgccttacaaatgagaaaaatacctaggactatg
tcaacacagcatcctgataacgcaaaagttcctgagtggaaccaaggagaagcaataagc
ggtgaaaacgagatcatcgaggcatatttggctttctccaggtatggtgtggaggaggta
atgtgggatgctgaaggtaaggacgtggacactcatgtagtgagaaaattactaagtcaa
tacccagaatttttcagacataggatattaggcaaggatattttcctgacgtatagggtt
ccaaatccaaaaatagagggtgctgagagaaaagtctttgctgaaacgctaaatactata
ccaataacatatgacttagctgagaagttttacggcgaaaatcctaatccaccagtcttt
gaagttattttaccttttacaactagttatgaagagttaattgcagtcatcaagttttat
gagaaagtaatagttaacagtgacaatacgaagctagttgatgatacttatgtaaaggat
attataggtgagacaaatcctaagaagatcgaagtaattcctctaatagaagatagagat
tcaatgttaagaatagatacaatagttgggaaatacatagaaatagagagacctccatat
ctgagagtattcttagcaagatcagatccagctatgaattacggtttattgtcagctgtt
ctgtcagtcaaatatgcattaagtagactttcgaaaatggaaaagatttatggagtgaaa
atatttcctttacttggagtcggttctttacccttcaggggtcattttagtccatataat
gttgaaaataccttgaatgaatatagaggcatatatacctttactgttcaatcagcgttc
aaatatgactatgaagatgaccttgtgatcagtgcaataaagaaagtaaatgggactaac
gtaaccgaaaaaattgaattaagtgaggaagatgaggagatcatttccaacgtaacgaga
aaatacacgcaaggttatcagaataagatagaggcattagccgatgttataaacaaagtg
gcattactgcttcctagaagaagagcaaggaaattacacataggtttgtttggatattct
agaagcacaggtaaggtaacactacctagagctatttcctttgttggctctctttatact
ataggtattccacctgagattataggactttcctctctatcaaaaatgactgatcaagaa
cttaatgccatattcaataattacaagtatttgaagaacgatctgcaattcgcagctcgt
ttcgttaactttgaagctcttcaattacttaaagatatatggaatattgatgcagaggtt
gtcaaagctataaaggaagatatagactacgcagaaaatagtttgggaattagaataggc
gaaagtgattatatgagcaaaaaacacgttctactctctaccctggcactattgtccata
aaagagggtaaattggacgaggctaaaacgtatataaaagaaatggctatagtaagaaga
gcaataggatga

DBGET integrated database retrieval system