KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0754Help
Entry
Saci_0754         CDS       T00251                                 

Definition
(GenBank) conserved Archaeal protein
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00300  Lysine biosynthesis
sai01100  Metabolic pathways
sai01210  2-Oxocarboxylic acid metabolism
sai01230  Biosynthesis of amino acids
Module
sai_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:sai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Saci_0754
Enzymes [BR:sai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     Saci_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST CPSase_L_D2 ATP-grasp_3 ATP-grasp_5 ATP-grasp Dala_Dala_lig_C ATP-grasp_2 Fungal_lectin
Motif
Other DBs
NCBI-ProteinID: AAY80130
UniProt: Q4JAP9
LinkDB All DBs
Position
602673..603503
Genome map
AA seq 276 aa AA seqDB search
MRWEEKDIITEAKKSGFKAIPIFTKDFYSAIGVGENYSELEADVIIQRNTSHARALTTSL
IFEGWNYNVVNDATSLFKCGNKLYTLSLLAKHNIKTPRTIVTFSKDKAVDLAKKIGFPAV
IKPIEGSWGRMVAKAVDEDILYSFLEYQEYTTSQFRQIYLVQEFVKKPNRDIRIFVMGDE
APVGIYRVNERNWKTNTALGARALPLKIDDELRDLALKVRDIMGGFFLGIDIFEDPERGY
LVNEVNGVPEYKNTVRVNNFNVSSYLLNKLREWIKK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgagatgggaagagaaggacataataactgaagccaaaaaaagcggatttaaggcaatt
cctatatttacaaaggatttttattctgcaataggagtaggcgaaaattacagtgaatta
gaggcagatgttataatacagagaaatactagccatgcaagggcattaaccacatcttta
atttttgagggatggaattataatgtagtaaatgatgcgacaagtttgtttaaatgtggt
aataaactatatacattatctttattagctaaacataatattaagactcctagaactatt
gtaactttttcaaaagataaagctgtagatttagctaaaaaaattggatttcctgctgta
ataaaaccaatagaaggtagttggggaagaatggttgcgaaggctgtagatgaagacatt
ttatatagctttctagaatatcaggaatatacaacaagtcaatttaggcagatctattta
gtacaagaatttgttaaaaaaccaaatagagacattagaatatttgtaatgggagatgag
gcaccagttggaatatatagagttaatgaacgtaactggaaaacaaatacagcattaggc
gccagagctttaccgttgaaaatagatgacgaactaagggacttagctcttaaagtgaga
gatataatgggtggattctttttgggtatagatatttttgaggatcctgaaagaggatat
ttagtaaatgaggtgaatggtgtaccggaatataaaaatactgtaagagttaataatttc
aatgtatcgtcataccttttaaataaacttagagagtggattaagaaatga

DBGET integrated database retrieval system