KEGG   Sphingopyxis alaskensis: Sala_0014Help
Entry
Sala_0014         CDS       T00361                                 

Definition
(GenBank) glutathione S-transferase-like protein
Organism
sal  Sphingopyxis alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABF51740
UniProt: Q1GN75
LinkDB All DBs
Position
complement(10373..11044)
Genome map
AA seq 223 aa AA seqDB search
MMIKLYGTPPTRALRAIWLLNELDLPHEIIPIDLGAGEQLTPDFMALNPAAKLPVLVDGA
MVVSESAAIQLYLADKYGERFPGGGLIPATAEDRGRMYHWLFFLMTEIEAPLWRIALHNF
IYDPEEKSEAEIALAKRDAARMVAVLEQHMQGRDVLVGDALTVADFNAAFTLDWAREEAL
LDDAPALRAFLDRMYARPRAPVTIAAAFAALEAVAADADGARA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcaaactttacggaaccccgccgacccgcgccctgcgcgcgatctggctgctc
aatgaactcgacctgccgcacgagatcatcccgatcgacctcggcgcgggcgaacagttg
acgcccgattttatggcgctcaaccccgccgccaagctgccggtgctcgtcgatggcgcc
atggtggtcagcgaatcggcggcgatccagctctatctcgccgacaaatatggcgaacgc
ttccccggcggcgggctgatccccgccactgccgaagatcgcggccgcatgtatcactgg
ctgttcttcctgatgaccgagatcgaggcaccgctgtggcggatcgcgctccacaatttc
atctatgatcccgaggaaaagtcggaggccgaaatcgcgctggcgaagcgcgacgccgca
cggatggttgcagtgctcgaacagcatatgcaggggcgcgacgtcctggtcggcgacgcg
ctgacggtggccgatttcaacgccgccttcacgctcgactgggcgcgcgaggaagcgctg
ctggacgatgccccggcgctccgcgcctttctggaccgcatgtacgcgcggcccagggcg
ccggtgacgatcgctgcggcatttgcggcgctggaggcggtggccgccgacgccgacggg
gcgagggcttga

DBGET integrated database retrieval system